Details for Chinese cabbage Locus Brara.G01681

Position : A07 ( 5`- 16342151 .. 16345493 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01681

Protein [Map View]
MKLTATNDLFASQPSLHFPCLSSSSSSSLPRRHGLHLPINLTRKNNSLSIVALSDSDPPSSTAFSRRAILLAPPLLSAAA
SLFLKPSVSLASEETSSATVTSPAEPATPPPPPPPQSTSVNKEETITSRIYDATAIGEPMAMGKDKKKVWEKLMNARVVY
LGEAEQVPTKDDKELELEIVRNLRKRCLESERQISVALEAFPLDLQEQLNQYMDKRIDGETLKSYVTDWPAQLWQEYEPL
LTYCRDNAVRLIACGTPLKVLRTVQAEGIRGLSKSERKLYTPPAGSGFISGFSSFSRRSTFDMSLPTQIVPFGPSSYLSA
QARVVEDHTMSQVILQAVADGGGTGLLLVVTGASHVEYGSRGTGLPARISRKFPKKNQVVVLLDPERQYLRREGETPVAD
FLWYSAARPCSRNCFDRAEIARVMNAAGRRRDALPQDIQNGLDLGLVSPEVLQNLFDLEQYPLISELAQRFQGFRERLLA
DPKFLNRLAIEESISITTTLLAQYEKRKENFFEELDYVITDTVRGSVVDFFTVWLPAPTLSFLSYADETAGPDSIDALRG
LLGSIPDNAFQKSLAGREWNLNLRVAAVIVGGLKLAGVGVVSSFAAVGASNALNGVRKVIKPELVVAQKPKRSPLLKTAM
VYGGFLGTSANLRYQIIAGLIEHRISDELSSQPLLVNTISFVVRTLNSYFGTQQWIDLARSTGLQSQKSTPASKDVPEAL
EETTVECNATEEENVDKLDNQ*

DNA
ATGAAACTCACGGCCACGAATGATCTCTTCGCTTCTCAACCATCCCTTCACTTCCCCTGCCTCTCCTCCTCCTCCTCCTC
CTCCCTTCCTCGCCGCCATGGCCTTCATCTCCCGATTAACCTCACTAGAAAGAACAATTCTCTCTCCATCGTTGCTCTCT
CTGATTCCGACCCTCCTTCCTCAACCGCCTTCTCCCGCCGCGCTATTCTCCTCGCGCCGCCACTCCTCTCCGCCGCTGCT
TCCCTGTTTCTAAAGCCGTCTGTCTCTTTAGCCTCAGAAGAGACCTCTTCCGCCACTGTGACCTCTCCTGCGGAACCAGC
AACTCCTCCTCCTCCTCCACCGCCGCAGTCTACGTCAGTGAACAAGGAAGAGACTATAACGTCAAGAATCTATGACGCGA
CAGCTATCGGTGAACCGATGGCTATGGGGAAAGACAAGAAGAAGGTGTGGGAGAAGCTGATGAACGCAAGGGTTGTCTAC
CTCGGGGAAGCTGAGCAGGTTCCTACCAAAGACGATAAGGAACTCGAACTCGAAATCGTTAGAAACTTGAGGAAGAGATG
CCTCGAGAGCGAGCGTCAAATCTCTGTGGCGTTGGAAGCGTTCCCTCTTGATTTGCAGGAACAGCTCAACCAGTACATGG
ATAAGAGGATTGACGGAGAGACGTTGAAGTCTTATGTAACAGATTGGCCAGCTCAACTTTGGCAAGAATATGAACCCCTT
TTAACTTATTGTCGTGATAACGCTGTTAGACTCATTGCTTGTGGCACTCCTCTCAAGGTTTTAAGAACTGTCCAAGCAGA
AGGTATCCGCGGTCTTTCAAAGTCTGAGCGCAAACTCTACACTCCCCCTGCTGGCTCCGGGTTCATCTCAGGCTTCTCTT
CGTTTTCACGTAGATCTACATTCGACATGAGCCTCCCTACACAGATCGTTCCCTTTGGACCAAGCTCTTATCTGTCTGCA
CAAGCAAGAGTTGTGGAAGACCACACAATGTCACAAGTTATTCTACAAGCAGTAGCAGATGGAGGTGGGACTGGTCTGCT
GTTAGTTGTGACAGGAGCAAGTCATGTTGAGTATGGTTCAAGAGGAACAGGTTTGCCAGCAAGGATCTCGAGGAAGTTCC
CAAAGAAAAACCAAGTTGTTGTGTTGCTTGACCCTGAAAGACAGTACCTGCGAAGAGAGGGAGAAACTCCAGTTGCTGAT
TTCTTGTGGTATTCTGCAGCTAGACCTTGTAGTAGAAACTGCTTTGACCGAGCAGAGATTGCTCGAGTGATGAATGCAGC
TGGCAGAAGAAGAGATGCTCTTCCACAGGATATTCAAAATGGATTGGATCTTGGTTTGGTGTCACCTGAGGTTCTGCAGA
ACTTGTTTGATTTGGAGCAGTATCCTCTCATCTCTGAGCTTGCTCAGCGGTTCCAGGGTTTCAGAGAAAGGTTGTTGGCA
GACCCCAAGTTTCTTAACAGGTTAGCTATTGAAGAGTCCATATCAATAACAACCACACTTCTAGCACAATACGAGAAGCG
AAAAGAGAACTTCTTTGAAGAGCTAGATTATGTTATAACCGATACAGTGAGAGGATCAGTTGTTGATTTCTTCACGGTTT
GGCTTCCTGCACCTACTTTGTCTTTTCTTTCCTATGCTGATGAGACCGCTGGACCAGACAGCATAGACGCCTTGAGAGGC
CTCCTAGGATCCATACCTGACAATGCATTTCAGAAAAGTCTTGCTGGAAGAGAGTGGAACTTGAATCTTAGAGTCGCTGC
TGTTATTGTTGGTGGCTTGAAGCTTGCAGGTGTTGGAGTTGTTTCCAGTTTTGCAGCTGTGGGAGCTTCAAATGCGTTGA
ATGGTGTTCGAAAAGTGATTAAACCAGAGTTGGTTGTTGCTCAGAAACCTAAGAGATCTCCTCTTCTGAAGACAGCAATG
GTGTATGGAGGTTTCTTGGGAACTTCTGCAAACCTTCGTTACCAGATAATAGCTGGATTAATAGAGCATCGTATATCTGA
TGAGCTTTCTTCGCAACCTTTACTAGTGAATACAATTTCATTTGTTGTCAGGACACTTAACTCATATTTTGGAACACAGC
AATGGATTGATCTTGCTCGTTCTACGGGTCTGCAATCTCAGAAAAGCACACCAGCCTCTAAGGATGTTCCTGAGGCTTTG
GAAGAAACTACGGTGGAGTGCAATGCTACTGAAGAGGAGAATGTTGACAAGCTTGATAACCAATGA