Details for Chinese cabbage Locus Brara.G01680

Position : A07 ( 5`- 16340035 .. 16341091 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01680

Protein [Map View]
MSTPPTLPITNQQAVQSQPPINTPAFRTFFSRLSTSIRDGLSQRRPWAELVDRSSMARPESLTDALSRIRKNLAYFKVNY
VAVVSLVLAFSLFSHPLSLLVLLGLLAGWMFLYLFRPSDQPLVVFGRTFSDRETLLALVLSTVVVVFMTSVGSLLTSALM
IGVAIVCVHGAFVVPDDLFMDDQEPANAGLLSFLGGSATSAAASAVAARV*

DNA
ATGTCCACTCCACCGACCCTCCCCATCACCAATCAGCAAGCTGTTCAATCCCAGCCACCAATCAACACCCCCGCCTTCCG
CACCTTCTTCTCACGCCTCTCCACCTCGATCCGCGACGGCTTATCACAACGCCGCCCCTGGGCGGAGCTCGTCGATCGGA
GCTCCATGGCGCGACCTGAATCCCTCACCGACGCCTTGTCCCGGATCCGGAAGAATCTCGCCTACTTCAAGGTGAACTAC
GTCGCCGTCGTCTCCCTCGTCCTCGCCTTCTCGCTTTTCTCGCACCCTCTCTCCCTCCTCGTCCTCCTCGGCCTCCTCGC
CGGCTGGATGTTCCTCTACCTCTTCCGCCCGTCGGATCAGCCGCTCGTCGTCTTCGGGCGCACCTTCTCGGATCGAGAGA
CTCTCCTTGCTCTCGTCTTGTCTACGGTCGTTGTCGTGTTTATGACGAGCGTTGGATCGCTTTTGACGTCCGCGTTGATG
ATTGGAGTCGCGATTGTTTGCGTTCACGGCGCGTTTGTGGTTCCGGATGATCTGTTCATGGACGATCAAGAGCCTGCTAA
CGCTGGGTTACTCTCCTTCCTTGGTGGCTCTGCTACTTCGGCGGCGGCTTCAGCTGTTGCGGCGAGAGTTTAA