Details for Chinese cabbage Locus Brara.G01678

Position : A07 ( 5`- 16329772 .. 16331412 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01678

Protein [Map View]
MLLKAASTFSLMTVHGVKKDVSPLSSSVSSGRNLSFSVRASTQPLSGVVFEPFVEVKKELDLVPSSPQLSLARHLYSPEC
EAAVNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKDSSVEERDHAEMLMEYQNKRGGRVKLQPMVMPQSEFDHAE
KGDALYAMELALSLEKLVNEKLLNVHSVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRRLGKGHGTWHFDQKLL
ETAAA*

DNA
ATGCTTCTCAAAGCTGCCTCTACGTTCTCGCTCATGACCGTTCACGGAGTGAAGAAGGACGTCTCTCCTCTCTCCTCCTC
CGTTTCATCGGGGAGAAACCTCTCCTTCTCTGTTCGTGCCTCCACGCAGCCACTAAGCGGCGTCGTTTTCGAGCCGTTCG
TGGAGGTGAAGAAGGAGCTCGATCTCGTCCCTTCGAGTCCGCAGCTTTCGCTCGCTCGACATTTGTACTCCCCTGAGTGC
GAAGCCGCCGTCAATGAGCAGATCAATGTTGAATACAATGTGTCGTATGTGTATCACGCTTTGTACGCTTACTTCGACCG
TGACAACGTTGCTCTGAAAGGTCTTGCCAAGTTTTTTAAGGACTCGAGTGTGGAGGAACGAGACCACGCTGAGATGTTGA
TGGAGTATCAGAACAAACGTGGTGGGAGGGTTAAGCTACAGCCTATGGTGATGCCTCAGTCTGAGTTTGATCACGCTGAG
AAAGGAGATGCTCTCTATGCCATGGAGTTGGCTCTATCATTGGAGAAACTGGTCAATGAGAAGCTCTTAAATGTGCACAG
TGTGGCTTCGAAGAACGATGATGTCCAGTTGGCAGATTTCATCGAGAGCGTGTTTTTGAACGAACAGGTTGAAGCTATTA
AGAAAATCTCGGAGTATGTCTCTCAGCTTAGAAGACTCGGCAAAGGACATGGGACATGGCATTTCGATCAGAAGCTTTTG
GAAACTGCTGCTGCTTAA