Details for Chinese cabbage Locus Brara.F03394

Position : A06 ( 5`- 26455637 .. 26456813 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.F03394

Protein [Map View]
MKLLHASLCLISLLLILPSIFAASSSEDFDFFYFVQQWPGSYCDTQRSCCFPTSGKPAADFGIHGLWPNYKDGTYPSNCD
NTKPFDSSSISDLISSMQKSWPTLACPSGSGETFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKADLLGALTKAGINPD
GKSYSIESIRDSIKESTGFTPWIQCNTDESGNSQLYQVYLCVDRSGSGLIECPVFPRGKCGDEINFPSF*

DNA
ATGAAGCTTCTTCATGCATCACTGTGTTTGATCAGTCTTCTCCTCATCTTGCCTTCGATCTTCGCTGCTTCTTCCTCTGA
AGATTTCGATTTCTTCTACTTCGTCCAACAATGGCCAGGATCATACTGTGACACACAGAGGAGTTGTTGCTTTCCAACTT
CTGGCAAACCAGCTGCTGATTTTGGAATTCACGGTCTTTGGCCTAATTACAAAGATGGAACTTATCCTTCTAACTGTGAC
AACACTAAACCATTCGATTCATCTTCGATATCGGATCTGATCAGCTCAATGCAGAAGAGCTGGCCGACACTAGCTTGCCC
CAGCGGCTCAGGCGAGACGTTTTGGGAACACGAATGGGAGAAACATGGAACTTGCTCCGAATCGGTTATAGACCAACACG
AGTATTTCCAAACCGCTCTTAACCTTAAGCAGAAAGCCGATCTTCTTGGAGCTCTAACCAAAGCCGGAATCAATCCGGAT
GGAAAATCTTACAGTATAGAGAGCATCAGAGACTCGATCAAGGAGTCAACGGGTTTCACTCCTTGGATTCAATGTAACAC
AGATGAGTCTGGCAATAGCCAATTGTACCAAGTCTACCTCTGTGTTGACCGGTCCGGTTCCGGTTTAATCGAATGCCCGG
TTTTCCCTCGCGGAAAATGTGGAGATGAGATTAACTTCCCTTCTTTCTAA