Details for Chinese cabbage Locus Brara.F03382

Position : A06 ( 5`- 26386881 .. 26387858 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.F03382

Protein [Map View]
MDLLCWSSVCLLILTFLSPKTLSMRYEVHSGQMKCISEDIHAKSMSVGKYFIVNPNDEHHPLPDSHKIIVQVMSPQGTML
HEADNTESGQFSFTASETGSYLACITAVDHKPETTLTIDLDWRSGVHSQDWSKVVKKSQVEMMESSVKSLLDTIVSIHEE
MYYLHERGEEMHELNRSTNSKMALLSFLSLGICLSVAGFQFWHLKTFFEKKKLI*

DNA
ATGGATCTTCTTTGTTGGAGCTCGGTTTGTCTTTTGATCCTTACGTTTTTATCACCTAAAACACTATCAATGAGGTATGA
AGTTCATTCTGGTCAGATGAAATGCATATCTGAGGATATTCACGCAAAATCCATGAGTGTTGGCAAATACTTCATCGTAA
ACCCTAACGATGAACACCATCCTCTCCCTGATTCTCACAAAATCATCGTCCAGGTGATGTCACCACAAGGGACGATGTTG
CACGAAGCCGATAATACGGAGTCTGGTCAGTTCTCGTTTACTGCATCTGAGACCGGTAGTTACTTAGCGTGCATCACCGC
CGTCGATCATAAGCCGGAGACAACATTGACCATTGATTTAGATTGGAGGTCTGGTGTTCACTCCCAAGACTGGTCGAAAG
TGGTGAAGAAGAGCCAAGTCGAAATGATGGAGTCCTCGGTTAAGAGTTTGTTAGACACTATTGTTTCCATCCACGAGGAG
ATGTATTATCTACACGAAAGGGGAGAAGAAATGCATGAACTGAATAGATCCACAAACTCGAAGATGGCGTTGTTGAGTTT
CTTATCGCTCGGGATTTGTTTATCGGTGGCTGGTTTTCAGTTTTGGCACTTGAAAACTTTCTTCGAGAAAAAGAAACTCA
TCTGA