Details for Chinese cabbage Locus Brara.F03375

Position : A06 ( 5`- 26363536 .. 26366042 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.F03375

Protein [Map View]
MGLKRPFDAEEMQECNAKHARQLTYHPDQFDQSMPFHVPLDKTAVLGEDLNGLCEKKPAWSNAADHVEKDYDTCAPFSWV
STGLCQEDAQTQSSLSHESSGSDLAWRPLSPVEDVYTSLMNQPPRKLVPLGSNHQADIPECESPVQANDDLERKLMGKCI
IPMPDTDLCGAGQGRKECLCPDKDTVRCVRRHIMEARESLIEAIGYERFTELGLCEMGDEVISLWSEDEEDLFHKVVYSY
PVSLGRDFWKQLKATFPSRTMKELVSYYFNVFILRRRATQNRLQTLDVDSDDDEWQVEYDVFCKGKSSSHVDNEEEEEEA
NSSDDDDDDEDEEDSPANDAHCVYMDKVSREGGEVNVEDDSCMSFEVHDSNLVFPHSPVENRASHGSGLFSFDDACDGRL
ASSDCWTKNNDLLPTSNIMEEIFGKDEWGENGDNLKGK*

DNA
ATGGGATTGAAGAGACCTTTTGATGCTGAAGAGATGCAAGAGTGCAATGCAAAGCATGCAAGACAGCTTACTTACCACCC
TGACCAATTTGACCAATCTATGCCATTTCACGTTCCTCTGGACAAGACAGCTGTCTTAGGAGAAGATCTGAATGGCCTCT
GTGAGAAGAAACCGGCATGGAGTAATGCTGCAGATCACGTTGAGAAGGATTACGACACGTGTGCACCCTTCTCGTGGGTC
TCAACCGGTTTGTGTCAGGAGGATGCTCAGACTCAGTCATCACTTTCTCATGAATCTTCTGGATCAGACCTCGCATGGAG
ACCACTTTCCCCGGTGGAGGATGTTTATACTTCCCTGATGAACCAACCTCCAAGGAAACTAGTTCCTCTTGGGTCTAATC
ACCAGGCAGACATCCCTGAATGTGAGAGTCCTGTTCAAGCAAACGATGACTTGGAAAGAAAACTGATGGGAAAGTGCATC
ATACCAATGCCTGACACTGACCTTTGTGGAGCCGGTCAAGGAAGAAAGGAATGTCTCTGCCCGGATAAAGACACAGTCAG
ATGCGTGAGGCGACACATCATGGAAGCGAGGGAGAGCCTGATCGAAGCTATTGGATACGAAAGGTTTACAGAGCTAGGGC
TGTGTGAAATGGGGGACGAAGTTATAAGCCTATGGAGTGAAGACGAAGAAGATCTCTTCCATAAAGTTGTATACTCCTAT
CCTGTTTCGCTCGGTCGCGATTTCTGGAAGCAGTTAAAGGCGACGTTTCCTTCAAGAACCATGAAGGAGCTTGTTAGCTA
CTACTTCAACGTCTTCATCTTGCGGAGACGTGCAACCCAGAACCGGCTTCAAACCCTGGACGTTGACAGCGACGATGACG
AGTGGCAAGTGGAGTACGACGTCTTTTGCAAAGGGAAAAGCTCCTCACATGTAGATAACGAGGAGGAGGAAGAAGAAGCC
AATAGCAGCGATGATGATGATGATGATGAAGACGAAGAAGACTCACCGGCTAACGATGCTCACTGTGTATATATGGATAA
GGTTTCAAGAGAAGGCGGTGAGGTGAACGTGGAAGACGACTCGTGTATGTCCTTCGAGGTGCATGACTCCAATTTGGTAT
TCCCTCACAGCCCTGTTGAAAACAGAGCGTCCCACGGATCTGGTTTGTTTTCTTTCGATGATGCGTGTGATGGAAGACTC
GCATCTTCTGACTGTTGGACCAAGAACAACGACCTTCTACCAACTTCGAACATCATGGAGGAGATATTTGGTAAAGACGA
ATGGGGAGAGAATGGTGATAACTTGAAGGGGAAGTAG