Details for Chinese cabbage Locus Brara.E03488

Position : A05 ( 5`- 27587133 .. 27588777 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03488

Protein [Map View]
MTSSQGDMDLEEWELLPKSYLKDLDHDEDHQEAMILDCFLSPSTQDPLHKIESPPISRVVPTKLLQVPIAWEPVLDHENK
KMPGLDPDPTQTLLMESVPSPRVSFKKTKETEFADMKIDPPARIMSPVPLIDAAKPSDCEGSDDLRVKKENDDVTSEHGG
EKLNLWKIGLNGIGAVCSFGVAAAAATVCVLFLGHNNIKVCKNKNHKLRFQIYSDDHKRMNEAVNQATKVNEAIFAMKGV
PVVRAQISFGGYYGL*

DNA
ATGACATCATCTCAAGGAGACATGGATCTTGAGGAGTGGGAGTTACTCCCAAAAAGCTATTTAAAGGATCTTGATCATGA
TGAGGATCATCAAGAAGCCATGATACTGGATTGCTTCCTCTCCCCATCTACTCAAGATCCTCTCCATAAGATAGAGTCTC
CTCCAATATCCAGAGTTGTCCCCACAAAGCTCCTCCAAGTCCCCATAGCTTGGGAACCCGTGTTGGATCACGAGAATAAG
AAGATGCCCGGTCTTGACCCGGATCCAACACAGACCCTTTTGATGGAGTCTGTCCCGTCACCAAGAGTATCCTTCAAGAA
AACGAAGGAAACTGAATTTGCCGACATGAAAATTGACCCACCAGCGAGGATCATGAGTCCTGTGCCTTTGATAGATGCTG
CGAAGCCCTCTGATTGCGAAGGAAGCGATGACTTGCGAGTTAAGAAAGAAAATGATGATGTGACGAGTGAACATGGTGGT
GAGAAACTGAACTTATGGAAGATTGGTCTTAATGGGATCGGAGCTGTTTGCTCTTTTGGCGTTGCAGCAGCTGCTGCTAC
AGTATGTGTCTTGTTCCTCGGACACAACAACATCAAAGTTTGTAAGAACAAGAACCATAAGCTTAGGTTCCAGATTTACT
CCGATGATCACAAGAGGATGAATGAAGCTGTGAATCAAGCAACAAAGGTTAATGAAGCAATCTTTGCAATGAAAGGTGTT
CCTGTCGTAAGAGCTCAAATATCTTTTGGAGGTTACTATGGACTTTGA