Details for Chinese cabbage Locus Brara.E03487

Position : A05 ( 5`- 27585068 .. 27586451 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03487

Protein [Map View]
MSSLEQEMFLQWGNKKRMRRLRASANKDNKHISQRQSNSSSHETFLFHSSRFSRGSEGAILRSGGSLPEKEKEERYYTTR
GVVDTNGEDSNGKGEESMWPKLFVTLSSKEKEEDFMAMKGCKPSHRPKKRAKLIQKSLLLVSPGTWLADMCPDRYDVRVK
KSSKKRRARGLKAMGNNIDSDSD*

DNA
ATGTCGTCGTTAGAACAAGAAATGTTCTTACAGTGGGGAAACAAGAAGAGAATGAGACGCCTAAGAGCCTCCGCCAACAA
GGACAACAAACACATCTCGCAACGCCAATCTAACTCTTCATCTCACGAGACCTTCCTCTTTCACTCCTCGAGATTCTCCA
GAGGATCAGAAGGGGCAATACTCAGATCCGGAGGATCACTACCAGAGAAAGAGAAAGAGGAGAGGTATTACACTACGAGA
GGCGTTGTTGATACCAACGGAGAAGACAGCAACGGCAAGGGAGAGGAGAGCATGTGGCCGAAGCTGTTTGTGACGCTGTC
GAGCAAAGAGAAGGAAGAAGACTTCATGGCTATGAAAGGCTGCAAACCTTCGCATAGGCCTAAGAAGAGAGCCAAACTCA
TCCAAAAAAGCTTACTCTTGGTGAGTCCTGGAACATGGTTGGCTGATATGTGTCCGGATAGATATGATGTTAGGGTCAAG
AAGAGCTCTAAGAAGAGGAGAGCAAGAGGATTAAAAGCAATGGGGAATAATATTGATAGCGATTCAGATTGA