Details for Chinese cabbage Locus Brara.E03486

Position : A05 ( 5`- 27582486 .. 27584948 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03486

Protein [Map View]
MKSVVAHFSTPLIAGARFFPPTCLIHPKSISTVRRRKFSSSLTVMASAAQSSSQAVSPGSVSGETDVFKLIQAHEAKAAR
LSPVEEIRTVLNGSVCGMLSTFSQKYEGYPSGSMVDFACDADGSPILAVSSLAVHTKDLIANPKCSLLVARDPEDRTGLR
ITLHGDAVLVSDKDQAAVRSAYLAKHPNAFWVDFGDFSFMRIEPKVVRFVSGVATAFLGSGEFNKEEYQAAKVDPIAQFA
KPVTSHMNKDHEEDTIAIVHHATSIPVESALMLDLDSLGFNVKATLQGNTFKLRVPFPRRAQDRKDVKTLIVEMLQAAKS
VSN*

DNA
ATGAAGTCGGTGGTTGCTCATTTCTCAACGCCTTTAATCGCAGGAGCTAGATTCTTCCCTCCTACATGTCTTATCCATCC
AAAATCGATCTCCACCGTTCGCCGTAGAAAGTTCTCCTCCTCTCTCACCGTGATGGCCTCAGCAGCTCAGTCTTCTTCCC
AGGCTGTATCACCGGGGAGTGTGAGCGGTGAGACAGATGTTTTCAAATTGATTCAAGCTCATGAGGCGAAGGCTGCTCGT
CTTTCTCCTGTTGAGGAAATACGAACAGTGCTTAACGGTAGTGTTTGTGGTATGCTTTCCACTTTCTCTCAGAAGTATGA
GGGTTATCCTTCAGGATCAATGGTTGATTTTGCATGTGATGCTGATGGTTCTCCGATTCTAGCAGTTAGTAGCTTGGCTG
TCCATACAAAGGATCTGATAGCTAATCCAAAATGCTCACTACTGGTTGCTAGAGACCCAGAGGATAGGACCGGTTTGAGG
ATCACCCTACACGGTGATGCAGTGTTGGTTTCTGACAAAGACCAAGCGGCTGTTCGATCTGCCTATTTAGCCAAGCATCC
CAATGCTTTCTGGGTTGATTTTGGAGACTTCAGCTTTATGCGAATTGAACCAAAAGTTGTCAGATTTGTCTCAGGGGTTG
CAACTGCTTTTCTAGGATCTGGAGAATTCAACAAAGAGGAGTACCAAGCAGCCAAAGTAGATCCTATAGCTCAGTTTGCA
AAGCCTGTAACGTCACACATGAACAAAGATCATGAAGAGGATACCATAGCCATTGTACACCATGCAACATCCATACCTGT
GGAGAGCGCCTTGATGCTTGATTTGGACAGCCTTGGTTTCAATGTTAAGGCTACTCTTCAAGGGAACACCTTCAAGCTCC
GAGTTCCGTTCCCAAGACGCGCACAAGACAGAAAGGATGTGAAGACACTGATAGTGGAAATGCTTCAAGCTGCCAAGTCT
GTTTCCAATTAG