Details for Chinese cabbage Locus Brara.E03483

Position : A05 ( 5`- 27572916 .. 27574791 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03483

Protein [Map View]
MNALAATNRNFKLASRLLGLDSKLEQSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVEPDEV
NALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSISELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKF
HGHSPAIVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKSIAGQRFAIQILKDDKFSVACGFGNVGSWAAKLINEKG
GKIVAVNDVTGAIKNKDGINISGLLEHTEENVGVKGFDGADAIDADSVLVEDCDILIPAALGGVIHRENANEIKAKFIIE
GANHPTDPEADEILRKKGVVILPDIYANSGGVIVSYFEWVQNIQGFMWDEEKVNKELKSYMTRGFKDLKEMCKTHSCDLR
MGAFSLGVNRVAQATVIRGWGS*

DNA
ATGAATGCTTTAGCGGCAACCAACAGAAACTTCAAGCTTGCTTCTAGGCTTCTTGGTTTGGACTCAAAGCTCGAGCAAAG
TCTTCTCATTCCCTTCAGAGAAATCAAGGTGGAATGTACCATACCAAAAGACGATGGAACTCTTGCATCATTCGTTGGAT
TCAGAGTCCAGCATGACAATGCAAGAGGTCCCATGAAAGGTGGCATCAGATATCATCCAGAGGTGGAACCGGATGAAGTA
AACGCATTGGCACAGCTCATGACATGGAAAACAGCTGTGGCTAAGATACCTTACGGTGGAGCCAAAGGAGGGATTGGTTG
TGACCCGAGCGAGCTAAGCATCTCAGAGCTCGAACGTTTGACACGAGTTTTTACACAGAAGATCCATGACCTCATTGGTA
TTCATACCGATGTTCCTGCTCCGGATATGGGAACCGGTCCTCAGACAATGGCGTGGATTCTTGATGAATACTCGAAATTT
CACGGACACTCTCCAGCTATTGTGACCGGCAAACCCATTGATCTTGGTGGATCACTGGGGAGAGATGCTGCTACAGGAAG
AGGAGTGTTATTCGCAACAGAAGCTCTACTCAATGAACATGGAAAGAGCATAGCTGGACAGAGATTCGCCATCCAAATAC
TTAAAGATGATAAGTTTTCAGTTGCTTGCGGTTTTGGAAATGTTGGTTCTTGGGCGGCGAAGTTGATAAATGAGAAAGGT
GGGAAGATTGTGGCAGTGAACGATGTGACAGGAGCAATCAAGAACAAGGATGGAATCAATATCTCTGGTTTGCTTGAGCA
TACCGAAGAAAACGTAGGAGTCAAAGGGTTTGATGGTGCTGATGCTATCGATGCTGATTCAGTTCTAGTTGAAGATTGTG
ATATCTTGATCCCTGCAGCTCTAGGTGGCGTCATCCACAGGGAAAACGCAAATGAGATTAAAGCAAAGTTCATCATTGAA
GGTGCTAATCATCCAACCGATCCTGAAGCTGACGAGATATTGAGGAAGAAAGGGGTTGTGATTCTTCCAGATATATACGC
AAACTCAGGAGGAGTCATTGTAAGTTACTTCGAGTGGGTTCAGAACATACAAGGATTCATGTGGGATGAGGAAAAGGTGA
ACAAGGAGCTAAAGAGTTACATGACTCGCGGCTTCAAAGATTTGAAAGAGATGTGTAAGACTCACTCATGTGATCTCCGT
ATGGGAGCTTTCTCCCTAGGTGTTAACCGTGTGGCTCAAGCTACCGTTATCAGAGGCTGGGGATCATGA