Details for Chinese cabbage Locus Brara.E03480

Position : A05 ( 5`- 27552792 .. 27556266 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03480

Protein [Map View]
MRELRSGARRSRRIEDHQPNPQLLQNILLPPPPQTATTRRRGGGVGGRGRGYAALAKAAAVPPRPTTAAGRGRGIRLTDL
EPEPCEVCPSAGVLGAAEAALNRVGGVADKDLAAEGGSPEKIAGMDEDSSMGPVPERVQVGNSPVYKTERKLGKGGFGQV
YVGRRVSGGSDRIGADAIEVALKLEHRNSKGCNFGPPYEWQVYNTLNSCYGIPDVHHKGRQGDFYILVMDMLGPSLWDVW
NSLAQSMSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDSHSGPHVEYDQRP
DVFRGTIRYASCHAHLGRTGSRRDDLESLAYTLIFLMRGRLPWQGYQGDNKSFLVCKKKMSTSPELMCCFCPPPFKLFLE
VVTNMKFDEEPNYAKLISIFDSLIEPCAVSRPIRIDGALKVGQKRGRLLINLEEDEQPRKKIRIGSPATQWISVYNARRP
MKQRYHYNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYISSIAG
ANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHR
RWESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC*

DNA
ATGCGAGAGTTAAGAAGTGGAGCTAGGAGATCGAGACGCATTGAAGATCATCAGCCTAACCCTCAGCTACTTCAAAACAT
CCTACTTCCTCCTCCTCCTCAGACTGCTACCACACGGAGAAGAGGTGGTGGTGTTGGTGGTAGAGGAAGAGGGTATGCTG
CTTTAGCTAAAGCCGCGGCTGTACCTCCTAGACCAACAACTGCTGCCGGTAGGGGGAGGGGTATCAGGTTGACTGACTTA
GAGCCTGAGCCTTGTGAGGTTTGTCCATCCGCTGGCGTTTTAGGGGCCGCTGAAGCTGCTTTAAATCGAGTTGGAGGGGT
AGCTGATAAGGATCTTGCTGCTGAAGGTGGTAGCCCAGAGAAAATAGCAGGCATGGATGAAGATTCCAGCATGGGTCCTG
TCCCTGAAAGGGTACAAGTTGGAAACTCTCCTGTTTATAAGACGGAGAGGAAGCTCGGTAAGGGTGGATTTGGTCAAGTT
TATGTTGGCAGAAGGGTGAGTGGTGGCAGTGATCGGATTGGAGCTGATGCAATTGAGGTAGCTCTGAAACTTGAACACCG
AAACAGTAAAGGATGCAATTTTGGCCCACCTTACGAGTGGCAAGTGTACAATACGCTTAATAGCTGTTATGGAATTCCTG
ATGTGCATCATAAGGGTCGTCAAGGAGATTTTTATATCCTGGTCATGGACATGCTTGGTCCTAGCCTTTGGGATGTTTGG
AATTCTTTAGCTCAATCGATGTCACCAAACATGGTAGCGTGCATTGCAGTGGAAGCGATATCTATTCTTGAGAAACTGCA
TATGAAGGGGTTTGTGCATGGAGATGTGAAACCAGAAAACTTTTTACTTGGTCAGCCTGGAACAGCAGACGAGAAGAAAC
TATACCTTATCGATCTTGGTCTAGCATCAAGATGGAAAGATTCACACTCTGGCCCGCATGTTGAATATGATCAAAGACCT
GATGTATTCAGGGGAACGATACGGTATGCAAGTTGTCATGCACATCTTGGTCGTACCGGAAGTCGGAGGGATGATCTGGA
ATCATTGGCCTATACATTAATATTTTTGATGCGGGGGAGGTTGCCATGGCAAGGGTACCAGGGTGACAACAAGAGCTTTC
TTGTGTGCAAGAAAAAGATGTCAACATCTCCTGAACTGATGTGCTGTTTCTGTCCTCCCCCGTTCAAGCTTTTCCTCGAG
GTAGTTACCAACATGAAGTTTGACGAGGAGCCTAACTACGCCAAGCTTATCTCGATTTTTGATTCTCTCATCGAGCCGTG
TGCTGTATCTAGACCGATTAGAATCGATGGGGCTCTGAAGGTTGGCCAAAAACGAGGAAGATTACTTATCAATTTGGAAG
AGGATGAACAGCCGAGGAAGAAAATCAGAATCGGCAGTCCTGCTACTCAGTGGATTTCAGTCTATAATGCACGTCGTCCT
ATGAAACAGAGATATCATTACAATGTTGCGGAGACAAGGCTGCCTCAGCATGTGGAGAAAGGTAACGAGGATGGCCTTTA
CATCAGCTGTGTAGCATCAGCAGCTAATCTCTGGGCCCTCATCATGGATGCTGGGACTGGGTTCAGCTCTCAAGTCTATG
AATTGTCCACAGTCTTCTTGCACAAGGACTGGATCATGGAACAATGGGAAAAGAACTACTATATCAGTTCCATAGCTGGT
GCTAATAACGGAAGCTCGTTGGTCGTTATGTCGAAAGGAACTCCTTATACCCAGCAATCTTACAAAGTCAGCGACTCATT
CCCATTCAAATGGATAAACAAAAAGTGGAAAGAAGGATTTCATGTAACCTCCATGACCACTGCTGGGAGTCGTTGGGGTA
TAGTAATGTCCAGAAACTCAGGCTACTCCGAACAGGTGGTGGAGCTGGACTTTTTGTACCCAAGTGAAGGAATCCATAGA
AGGTGGGAGAGTGGATTCAGGATAACATCAATGGCTGCAACAGCGGATCAAGCAGCTCTCATATTGAGCATACCTAAACG
AAAAATAACCGATGAAACCCAAGAGACTCTTCGCACTTCTGCTTTCCCAAGCACCCATGTCAAGGACAAATGGGCGAAAA
ATCTGTACATTGCATCAATATGCTATGGTCGGACCGTTTGTTGA