Details for Chinese cabbage Locus Brara.E03476

Position : A05 ( 5`- 27538032 .. 27539090 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03476

Protein [Map View]
MSQHNILEALNVRVVGTGDRILVLAHGFGTDQSAWHLILPYFTQTYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLL
SIIDSLGIQTCAYVGHSVSAMIGIIASIRRPELFTKLILIGASPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVQGYA
PLAVGADVPEAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPSCVIQTAKDVSVPASVAEYLRAHLGGDTTVE
TLKTEGHLPHLSAPAQLAQFLRRALPR*

DNA
ATGAGTCAACACAACATCCTCGAAGCTCTTAACGTCCGGGTCGTGGGCACGGGCGATCGGATCCTTGTCCTAGCCCACGG
GTTCGGCACAGACCAGTCCGCTTGGCACCTAATCCTCCCTTACTTCACCCAAACCTACAGAGTCGTCCTCTACGACCTCG
TCTGCGCCGGCAGCGTCAACCCCGACTACTTCGACTTCAACCGCTACACGACCCTCGACCCCTACGTGGACGACCTCCTC
AGCATCATCGACTCCCTCGGCATCCAAACCTGCGCTTACGTGGGCCACTCCGTCTCCGCCATGATCGGAATCATCGCCTC
CATCCGCCGCCCGGAGCTTTTCACGAAGCTCATCCTCATCGGAGCCTCGCCGAGGTTCCTCAACGACGAGGACTACCACG
GCGGGTTCGAGGAAGGGGAGATCGAGAAGGTGTTCTCGGCCATGGAGGCTAACTACGAGGCTTGGGTTCAGGGATACGCG
CCGTTGGCGGTTGGAGCCGATGTCCCCGAGGCGGTTAGAGAGTTTAGCCGGACGCTGTTCAACATGCGTCCGGATATCTC
TCTGTTCGTCTCGAGGACGGTGTTCAATAGTGATCTCAGAGGGGTTCTTGGGTTAGTGAGAGTGCCTTCTTGTGTGATTC
AGACGGCGAAGGATGTTTCTGTTCCGGCTTCGGTGGCGGAGTATCTCCGTGCTCATCTCGGTGGGGATACGACGGTGGAG
ACACTGAAGACTGAAGGTCATTTGCCGCATCTCAGTGCGCCGGCGCAGCTAGCTCAGTTTCTCCGGCGTGCACTTCCTCG
GTGA