Details for Chinese cabbage Locus Brara.E03472

Position : A05 ( 5`- 27527123 .. 27529184 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03472

Protein [Map View]
MKGSKANLSTLAEKCKTIIVSNWKGYLNTIKPEDKASIIHTSKVKYVMRRGKPYLWVPESEPHNVNIMFDERGSFSVSHP
YPGPLAALLKSIGKVPNRVALTGEIIPVKEKRIEAVNKYVEEAIQSEMRAISETPYSVRSILSSSDQMYASRCESLKALV
DGGNEKYVIYKFVPSSCMFIDANGANREIDLKVLELSKADPLGAWSTNLVDGINKDESRRRALILFCLYYLDINARDAYM
VSVDTKGFDLLGKVPSEEEAGDEYQWREFRFEFEEETKDVEAFCHQLVEMEQEVVNKFTDHTGL*

DNA
ATGAAAGGAAGCAAGGCGAATCTCTCTACACTAGCGGAGAAATGCAAAACTATAATCGTCTCGAACTGGAAAGGGTATCT
AAACACCATCAAACCTGAAGATAAAGCTAGTATAATACATACTTCAAAGGTTAAGTATGTGATGAGACGAGGAAAGCCTT
ATCTCTGGGTTCCTGAATCTGAACCCCACAATGTCAACATAATGTTTGATGAACGTGGATCCTTCTCCGTTTCTCATCCT
TATCCTGGTCCCCTTGCAGCTTTGTTGAAGTCAATAGGAAAGGTTCCAAACCGGGTTGCTCTAACTGGAGAAATCATCCC
TGTCAAGGAGAAAAGGATCGAGGCTGTGAATAAATATGTGGAGGAAGCTATACAATCAGAGATGAGAGCGATTAGTGAGA
CCCCATATTCGGTACGCAGTATCTTGAGTTCTTCCGACCAGATGTATGCCTCCCGGTGCGAGAGTCTTAAAGCCCTTGTC
GATGGTGGCAATGAGAAATACGTTATCTACAAGTTTGTTCCCAGCTCGTGTATGTTTATCGACGCAAATGGTGCTAATAG
AGAAATAGACTTGAAGGTCTTGGAGCTCTCAAAAGCTGATCCATTAGGGGCTTGGTCTACAAATCTTGTGGATGGAATCA
ATAAGGACGAATCGAGAAGACGTGCTTTGATCCTTTTCTGTTTATACTATCTCGATATCAACGCAAGGGATGCTTATATG
GTATCTGTGGATACGAAAGGATTTGACTTGCTGGGGAAAGTACCAAGTGAGGAAGAAGCTGGAGATGAGTATCAGTGGAG
AGAGTTTAGGTTTGAGTTTGAAGAAGAGACGAAAGACGTTGAAGCTTTCTGCCACCAGCTTGTGGAAATGGAACAAGAGG
TTGTGAACAAGTTCACTGACCATACCGGTTTGTAA