Details for Chinese cabbage Locus Brara.E03468

Position : A05 ( 5`- 27511838 .. 27513604 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03468

Protein [Map View]
MISKDPRSSLPPGFRFHPTDEELILHYLRKKVSSLPVPLSVIEDVDIYKSDPWDLPAKAPFGEKEWYFFSPRDRKYPNGA
RPNRAAASGYWKATGTDKLIAVPNGGVNENIGIKKALVFYRGKPPKGVKTNWIMHEYRLAETLSPKRVDHSSDSQFNNLG
DRSLKSREYSMRLDDWVLCRIYKKSHISLSPPHVATDTSNQEHEENDKEPFIVSETLLPNLENNQTLKRQKSSFSNLLDA
TDLTFLTNFLNETPEHHTEQEFSFMFENFSNPNIYGNPYLDQKLPRLSPPSSETSFIGNKRERMDYAEETTSTSKKMINN
FSYNI*

DNA
ATGATAAGCAAGGATCCAAGATCAAGTTTGCCACCAGGGTTTCGATTTCATCCAACTGATGAAGAACTCATTCTCCATTA
CCTAAGGAAGAAGGTTTCCTCTTTACCAGTCCCGCTTTCGGTCATCGAAGATGTCGATATCTATAAATCTGATCCATGGG
ATTTACCAGCTAAGGCTCCCTTTGGAGAGAAAGAATGGTATTTTTTCAGTCCGAGGGACAGGAAATATCCAAACGGAGCA
AGACCAAACCGAGCAGCTGCGTCAGGGTATTGGAAAGCCACCGGAACAGATAAATTAATTGCGGTACCAAACGGTGGAGT
TAATGAAAACATTGGTATAAAAAAAGCTCTTGTGTTTTATAGAGGAAAGCCTCCAAAAGGTGTTAAAACCAATTGGATCA
TGCATGAATATCGACTTGCTGAAACCCTATCGCCCAAAAGAGTGGACCATTCGAGCGACAGCCAATTCAATAATCTTGGA
GACAGGAGTTTGAAATCTAGAGAATACTCTATGAGGCTGGATGATTGGGTTCTTTGCCGGATTTACAAGAAATCACACAT
TTCACTGTCACCACCACATGTTGCTACTGATACAAGCAACCAAGAACATGAGGAAAATGACAAAGAACCATTCATAGTCA
GCGAAACCCTCTTGCCAAATTTGGAAAACAATCAAACACTTAAACGCCAGAAGTCTTCTTTCTCGAACTTATTAGACGCT
ACAGATTTGACGTTCCTCACAAACTTTCTAAACGAAACTCCGGAACATCATACTGAACAAGAGTTTTCTTTCATGTTTGA
AAATTTCTCAAACCCTAACATCTACGGAAACCCTTACTTGGATCAAAAGTTACCTCGGTTAAGCCCTCCTAGTTCTGAGA
CCAGCTTTATCGGAAACAAAAGAGAAAGAATGGATTATGCAGAAGAAACGACGAGCACTTCCAAGAAGATGATCAACAAC
TTTAGTTACAATATATAA