Details for Chinese cabbage Locus Brara.E03464

Position : A05 ( 5`- 27462353 .. 27464963 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03464

Protein [Map View]
MAGGKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKPVTV
FGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC
LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPQLNGKLTGMSFRVP
TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDN
EWGYSTRVVDLIVHMSKC*

DNA
ATGGCTGGAGGTAAGATCAAGATCGGAATCAACGGATTCGGAAGAATCGGTCGTTTGGTAGCTAGAGTTGTTCTCCAGAG
GGACGATGTTGAGCTTGTTGCTGTTAACGATCCCTTCATCACCACTGAGTACATGACGTACATGTTCAAGTACGACAGTG
TCCACGGTCAATGGAAACACCATGAGCTCAAGGTGAAGGATGAGAAGACTCTTCTCTTCGGTGAGAAGCCAGTCACTGTC
TTCGGCATCAGGAACCCTGAGGATATCCCATGGGGTGAGGCTGGAGCTGACTTCGTTGTTGAGTCTACCGGTGTTTTCAC
TGACAAGGACAAAGCTGCTGCTCACTTGAAGGGTGGTGCCAAGAAGGTTGTCATCTCTGCACCTAGCAAGGACGCGCCCA
TGTTTGTCGTTGGTGTCAACGAGCACGAGTACAAGTCCGACCTTGACATTGTCTCCAACGCTAGTTGCACCACTAACTGC
CTTGCTCCCCTTGCCAAGGTTATCAACGACAGGTTCGGCATTGTTGAGGGTCTTATGACCACCGTCCACTCCATCACTGC
TACTCAGAAGACTGTTGATGGACCATCAATGAAGGACTGGAGAGGTGGAAGAGCTGCTTCATTCAACATCATTCCCAGCA
GCACCGGAGCTGCCAAGGCTGTCGGAAAGGTTCTTCCACAGCTTAACGGAAAGTTGACCGGAATGTCCTTCCGTGTTCCC
ACCGTTGATGTCTCAGTTGTTGACCTCACGGTTAGACTCGAGAAAGCTGCAACCTACGACGAGATCAAGAAGGCTATCAA
GGAGGAATCTGAAGGCAAGCTAAAGGGAATCCTTGGATACACCGAGGATGATGTCGTCTCAACTGACTTCGTTGGTGACA
GCAGGTCGAGCATTTTCGATGCCAAGGCTGGAATTGCATTGAGTGACAACTTCGTGAAGCTTGTGTCGTGGTACGACAAC
GAATGGGGTTACAGTACTCGTGTGGTCGACTTGATTGTTCACATGTCAAAGTGCTAA