Details for Chinese cabbage Locus Brara.E03463

Position : A05 ( 5`- 27460120 .. 27461969 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03463

Protein [Map View]
MSRLIQNRVRNTFSRLKPSIALSSSTLTNNLSTSPEPSPEPLDESSEIWNVIIGRAGGDRVVSEDEVFHRLSNDPFCNRV
NLSDTLLNKLLHRFRDDWRSALGVLKWAESRKAHKNHSAEAYDTAVDILGKAKKWDRMKAFVEKMKVDNTVTLNTVAKIM
RRFAGAGEWEEAVNVFDRLNEFGLEKNTESMNLLLDTLCKEKRVERARSVLLELKAHIKPDAHTFNIFINGWCKTNRVEE
ALWTIQEMRGYGFRPCVISYTTIIKCYCLKSDFIKVYEMLSEMEANDSPPNSVTYTTIMSCLNAQKEFEESLRVAARMKR
SGCEGDTLFYNCLIHTLARAGRLEEAERVFRDEMPSVNTSTYNSMIAMYCHHDEEEKAVELLREMESLKVCEPDVHTYHP
LLRSCFKRGDVVEVGRLLKEMVTKHHLSLDESTYTFLIQRFCRADMCEWAYCLFEEMISQDIAPRHRTCLLLLDEVRKKS
MHEAVERIEHVMRTVKLTAPVK*

DNA
ATGTCTCGTCTCATCCAAAACCGCGTCAGAAACACTTTCTCACGCCTCAAACCTTCCATCGCTCTCTCCTCATCTACCCT
CACCAACAATCTCTCCACGTCTCCAGAGCCATCACCCGAACCACTCGATGAATCCTCGGAGATATGGAACGTCATCATAG
GCCGAGCCGGCGGCGACAGAGTCGTCAGCGAAGACGAAGTCTTCCACCGCCTCTCAAACGATCCCTTCTGCAACAGAGTA
AACCTCTCAGACACTCTACTCAACAAGCTCCTCCACAGGTTCAGAGACGACTGGAGATCAGCTCTCGGCGTCTTGAAATG
GGCCGAGTCTCGCAAAGCCCACAAGAATCACTCAGCCGAGGCTTATGATACAGCGGTTGATATACTCGGGAAAGCCAAGA
AATGGGATCGTATGAAGGCCTTCGTCGAGAAGATGAAGGTAGATAACACCGTGACGTTGAACACTGTGGCCAAGATCATG
AGGAGGTTCGCTGGAGCTGGAGAGTGGGAAGAAGCTGTTAACGTGTTCGATAGGTTAAATGAGTTTGGATTAGAGAAGAA
CACTGAGTCTATGAACTTACTGTTAGATACTCTCTGTAAGGAGAAGAGAGTCGAGCGAGCTAGATCCGTTTTGTTAGAGC
TAAAGGCTCACATTAAGCCGGATGCTCATACTTTTAATATATTTATTAACGGTTGGTGTAAGACCAACAGAGTCGAGGAG
GCTCTCTGGACGATTCAGGAGATGAGAGGATATGGGTTTCGTCCTTGTGTGATTAGCTACACGACGATTATAAAGTGTTA
TTGTTTGAAGAGTGATTTTATTAAAGTCTATGAGATGTTGAGTGAGATGGAAGCTAACGATTCTCCTCCGAACTCTGTCA
CCTACACGACGATTATGTCTTGTCTTAACGCGCAGAAAGAGTTTGAGGAGTCTTTAAGGGTGGCTGCGAGGATGAAACGG
TCAGGCTGCGAGGGGGATACTCTTTTCTACAACTGTTTGATTCACACGCTTGCTCGAGCTGGGAGGTTGGAAGAAGCTGA
GAGGGTTTTCAGAGATGAGATGCCTTCAGTTAACACATCTACTTATAACTCGATGATTGCTATGTATTGTCACCATGATG
AGGAGGAGAAGGCCGTTGAGCTTCTCAGGGAGATGGAGAGTTTGAAGGTTTGTGAGCCTGATGTTCACACGTATCATCCT
TTGCTTAGGTCTTGTTTTAAGAGAGGGGATGTGGTTGAGGTTGGGAGGTTGTTGAAAGAAATGGTGACTAAGCATCATTT
GAGTTTGGATGAGTCGACTTATACTTTTCTGATTCAGAGGTTTTGTAGAGCTGATATGTGTGAGTGGGCGTATTGTCTTT
TTGAGGAGATGATTAGCCAAGATATCGCGCCGAGGCATAGGACTTGTTTGTTGCTTTTGGATGAGGTTAGGAAGAAGAGT
ATGCATGAAGCGGTTGAGAGGATTGAACATGTGATGAGGACTGTTAAACTTACTGCGCCTGTAAAGTGA