Details for Chinese cabbage Locus Brara.E03462

Position : A05 ( 5`- 27456323 .. 27459257 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03462

Protein [Map View]
MPPPIFPLRWESTGDQWWYASPIDCAAANGLYDVVIELLHHDTNLLVKLTSLRRIRRLETVWDDDGDGDNSSSQVALNRS
RVARRLLEECEIGNGDNSLIRAGYGGWLLYTAASAGDLGFVKKLLERDPLLVFGEGEYGVTDVLYAAARGRNDDVFRLVL
DFALLPADIAGVEETDGGKLTERQLIVKEEMVKRGVHSAARGGHVAILEEFLLSGKYDAVLGLRDAHGSTLLHSASCRGQ
IKVVKYLITKYDSIMAIKDSHGNTALHIAAYKGHLAVMEALINESPPLISAVNNEGDTCLHMVVSGFAASGFKRLDRQME
LLKKLISGGGSLSVDFSKIVNVRNGNGRTVVHLAVMDVLNTVRLDVVEILLRVPGVDLNVADIDGMTPVDLLERQTPRTA
VSDLLIKRLKSAGGRSNGGCEKVIPFREERYGFCGSPGTAFEISDSEIFLFTAARTDHHHTASNAEMSPDRESLDGISEC
STEMTTHSKRKRSTGARLKLLLRWAKKEETEENRRFSGDDNNNRRVLPLREMYSRSMSPSEVGNRGRAFPMRTESGDLPS
LSVRLKFTEGLMKGVVVQESPRFVFSPPVVSDYSGAPSSACTSPFQTVSCELERKTPAVKKQRSFVNRYLCFSGKGLAID
GSSEMSSRLRPRSFKRVMSLVSS*

DNA
ATGCCGCCGCCGATATTTCCTCTCCGTTGGGAGAGCACCGGAGACCAGTGGTGGTACGCTTCACCAATCGACTGCGCAGC
CGCCAACGGTCTCTACGACGTCGTCATCGAGCTGCTTCACCACGACACGAACCTTCTCGTCAAACTCACCTCCCTCCGCC
GCATCCGCCGCCTCGAAACCGTCTGGGACGACGACGGCGACGGAGATAACTCCTCCTCCCAGGTGGCGCTGAACCGCTCT
CGCGTCGCGAGGAGGCTGCTGGAGGAGTGCGAGATCGGGAACGGAGATAACTCACTCATCAGAGCTGGATACGGCGGCTG
GCTGCTATACACCGCCGCCTCCGCCGGAGATTTGGGGTTCGTTAAGAAGCTTCTCGAGAGAGATCCGCTTCTCGTGTTCG
GAGAGGGAGAGTACGGCGTGACGGATGTTCTCTACGCGGCGGCGAGAGGTAGAAACGACGACGTTTTTCGTCTCGTGCTG
GACTTCGCTTTGCTGCCGGCTGATATCGCCGGCGTCGAAGAAACAGACGGCGGGAAACTGACGGAGAGGCAGTTAATAGT
AAAGGAAGAGATGGTTAAAAGAGGGGTCCACAGTGCTGCGAGAGGCGGACACGTGGCGATCTTGGAAGAGTTTTTACTCT
CTGGTAAATACGACGCCGTTTTGGGACTCAGAGATGCTCATGGTTCTACTCTCTTGCACTCTGCTTCTTGCAGAGGTCAA
ATCAAAGTGGTGAAGTATCTTATAACGAAGTACGATTCAATAATGGCGATTAAAGACAGCCATGGAAACACAGCTTTACA
CATAGCTGCTTACAAGGGTCACTTAGCTGTAATGGAGGCTCTAATAAACGAATCTCCACCGTTGATCTCAGCTGTTAACA
ACGAAGGTGACACGTGCCTACACATGGTCGTGTCTGGTTTCGCAGCCTCCGGGTTTAAGCGGTTAGACAGACAAATGGAG
CTTCTGAAGAAGTTAATCTCAGGAGGAGGAAGCTTGTCCGTTGACTTTTCTAAGATAGTCAACGTTAGAAACGGTAACGG
AAGAACTGTGGTTCATTTAGCCGTGATGGATGTTCTCAACACCGTTAGACTTGACGTCGTTGAGATTCTGTTGAGAGTCC
CAGGCGTTGATCTCAACGTTGCTGATATAGATGGTATGACTCCTGTTGATTTGCTTGAACGCCAAACGCCGAGAACTGCG
GTTTCTGATTTGTTGATCAAACGGCTTAAATCCGCGGGTGGGAGATCAAACGGCGGTTGTGAGAAGGTTATACCGTTTAG
AGAAGAGCGTTACGGGTTCTGCGGAAGTCCAGGAACTGCGTTTGAGATATCTGATTCCGAGATTTTTCTATTCACTGCGG
CTAGAACGGATCATCATCATACCGCTTCAAACGCTGAAATGAGTCCAGACAGAGAGAGTTTAGACGGGATCAGCGAGTGT
TCCACCGAAATGACAACGCATTCGAAACGCAAACGCAGTACAGGAGCGCGTCTCAAGCTTCTGTTGCGGTGGGCTAAGAA
GGAAGAAACAGAGGAGAATCGACGTTTCTCTGGAGACGATAACAACAACCGTCGTGTGCTGCCTCTCAGAGAGATGTATT
CGAGATCAATGTCGCCGTCTGAGGTGGGAAACAGAGGAAGAGCGTTTCCGATGAGAACAGAGAGCGGTGATCTCCCGAGC
TTATCGGTGAGGTTGAAGTTCACGGAAGGGTTGATGAAAGGAGTGGTGGTTCAGGAGTCTCCGAGGTTTGTGTTTTCTCC
TCCGGTGGTTTCTGATTACTCTGGAGCTCCGTCGTCGGCTTGTACGTCGCCGTTTCAGACGGTTTCTTGTGAACTGGAGA
GGAAAACACCTGCCGTGAAGAAACAGAGATCTTTTGTGAACAGGTACTTGTGTTTTAGCGGTAAAGGATTAGCCATTGAC
GGTTCTTCTGAGATGAGTTCTCGTCTTCGTCCTCGGAGCTTCAAAAGAGTCATGTCTTTGGTTTCTTCTTAA