Details for Chinese cabbage Locus Brara.E03458

Position : A05 ( 5`- 27441977 .. 27442990 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03458

Protein [Map View]
MLLFIPFPYNSIQYIAHIQDKHDQLLLVLSVIVVKCCCSSKSKEEEEEVPAGQVVKKTFKKLCVLVVDDDRSCRSLYMGF
IQMRGGFPYMAENGEEAVNLYRDGQTFNLILMDNEMPVMDGVSYDRAVFFSLVRQPRIVGLTSHEDENSGFMEAGADHCL
AKPITFENIYLLIEQLKDE*

DNA
ATGCTCTTGTTTATACCGTTTCCATATAATTCGATACAATATATAGCACATATTCAAGACAAACATGACCAGCTTTTATT
AGTGTTGTCCGTTATTGTTGTGAAGTGTTGTTGCAGTAGTAAATCAAAGGAGGAAGAAGAAGAAGTACCGGCAGGACAAG
TCGTGAAGAAGACATTTAAGAAACTATGCGTTTTGGTCGTTGATGATGATCGATCGTGCCGTTCACTGTACATGGGATTC
ATCCAAATGCGTGGAGGATTTCCTTACATGGCGGAAAATGGTGAGGAGGCAGTGAACCTCTACCGCGATGGCCAAACCTT
CAACCTTATCCTCATGGATAATGAAATGCCTGTGATGGATGGAGTTTCGTATGATAGAGCCGTTTTTTTCTCACTTGTTA
GGCAACCAAGGATCGTGGGATTGACGTCACATGAGGACGAGAATAGTGGATTTATGGAAGCTGGAGCTGACCATTGCTTG
GCCAAGCCCATAACATTTGAGAATATCTACTTGCTCATCGAGCAGCTAAAAGACGAATGA