Details for Chinese cabbage Locus Brara.E03457

Position : A05 ( 5`- 27433123 .. 27433644 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03457

Protein [Map View]
MATKSMGDIEKIKKKLNVLIVDDDPLNLIIHEKIIKAIGGISQTANNGEEAVIIHRDGGSSFDLILMDKEMPERDGVSTT
KKLREMEVKSMIVGVTSLADNEEERRAFMEAGLNHCLAKPLTKDKIIPLINQLMDA*

DNA
ATGGCAACAAAATCCATGGGAGATATCGAGAAAATAAAGAAGAAACTAAACGTGTTGATCGTCGATGATGATCCACTAAA
CCTTATAATTCATGAGAAGATCATCAAAGCGATAGGGGGTATTTCACAGACAGCAAATAACGGCGAGGAGGCAGTAATCA
TCCACCGTGACGGCGGCTCATCTTTTGACCTTATCCTAATGGACAAAGAAATGCCCGAGAGGGATGGAGTCTCGACAACT
AAGAAGCTAAGAGAAATGGAAGTGAAGTCAATGATTGTTGGGGTGACTTCACTGGCTGACAATGAAGAGGAGCGCAGGGC
TTTCATGGAAGCTGGACTTAACCATTGCTTGGCAAAACCGTTAACCAAGGACAAGATCATCCCTCTCATTAACCAACTCA
TGGATGCTTGA