Details for Chinese cabbage Locus Brara.E03455

Position : A05 ( 5`- 27423541 .. 27424376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03455

Protein [Map View]
MNIVIEHNPSSIKLSELGVMSWPKWSCQPGKYALVFEERETCYLVKGKVKVYPKGSSSEFVEFGAGDLVTIPKGLSCTWD
VSLFIDKHYKFDPPA*

DNA
ATGAATATCGTAATCGAACACAACCCTTCAAGCATAAAGTTATCTGAACTTGGAGTCATGTCATGGCCTAAATGGTCTTG
TCAGCCAGGGAAGTATGCATTAGTGTTTGAAGAAAGAGAGACATGCTATTTGGTGAAGGGAAAGGTGAAGGTGTATCCAA
AAGGGTCATCATCAGAGTTTGTAGAGTTTGGTGCAGGAGACCTTGTCACCATCCCCAAGGGACTTAGCTGCACTTGGGAT
GTATCTCTTTTCATCGACAAGCACTACAAGTTCGATCCCCCTGCTTAA