Details for Chinese cabbage Locus Brara.E03454

Position : A05 ( 5`- 27415957 .. 27422617 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03454

Protein [Map View]
MDFISASSSPVFTQLSHLSLSPGLVSLNLRSRVNKTRKLGSRESNKSRKIVAVRGCLGFASSSQSEAHVRSRELVCSAKR
KESVIQFVSKPLVYALFCIAIGFSPVRSFQAPALALPFVSDVIRKRKKETLIEKEVVLKSIDHEFSGYTRRLLETVSVLL
KSVEKVRKENGDAGEVGAALEAVKAEKEKLEKEIMSGLYSDLSRFRKEREVLMERADGIVEEVLRLKKESERMLGKGDRE
KAERLEERVDVMEREYNKIWERIDEIDDTVLKRETTTLSFGVRELMFIERECVELVKSFNREMKLKSSESIPEGSVTKLT
RSEIKQELLNAQRKHLEQVILPDVLELEEVDPLFDRDSVDFSLRIKKRLEESKKLQKDLQDRIRGRMKKFGEEKLFVVKT
PEGEVVKGFPEAEVKWMFGEKEVVVPKAIQLHLRHGWKKWQDEAKADLKQRLLEDVDFGKQYIAQRQEQVLLDRDRVVSK
TWYNEDKDRWEMDHMAVPYAVSRKLIDSARIRHDFAVMYVALKGDDKEYYVDLKEYEMQFEKFGGFDALYLKMLACGIPT
TVHLMWIPMSELSLHQQFLLFTRVVSRAFTALRKTPIVSQAKGILLERIRNINDDLMMAVVFPVLEFIIPYQLRLRLGMA
WPEEIEQSVGTTWYLQWQSEAEMNFRSRNTEDFKWFVWFLIRSFVYGYVVYHVFRFLKRKIPRVLGYGPFRRDPNVRKFW
RVKSYFTFRKRRIKQKRKAGVDPIKTAFDRMKRVKNPPIPLKNFASIESMREEINEVVAFLQNPKAFQEMGARAPRGVLI
VGERGTGKTSLALAIAAEARVPVVNVEAQELEAGLWVGQSAANVRELFQTARELAPVIIFVEDFDLFAGVRGKLIHTKQQ
DHESFINQLLVELDGFEKQDGVVLMATTRNHKQIDEALRRPGRMDRIFHLQSPTEMEREKILHNAAEETMDRELIDLVDW
RKVSEKTSLLRPIELKLVPMALESSAFRSKFLDTDELLSYVSWFATFSRIVPRWLRKTKVANKMGKMLVNHLGLNLTKED
LENVVDLMEPYGQISNGIELLNPPVDWTRETKFPHAVWAAGRALIALLIPNFDVVDNLWLEPSSWEGIGCTKITKVTSGG
SASGNTESRSYLEKKLVFCFGSHIASQMLLPPGEENFLSSSEITQAQEIATRMVLQYGWGPDDSPAVYYATNAVSALSMG
NHHEYEMASKVEKIYDLAYEKAKGMLLKNRRVLEKITEELLEFEILTHKDLERLVHENGGIREKEPFFLSGTSHNEPLSK
SFLDAGDSSETVLLSTQT*

DNA
ATGGATTTCATTTCCGCTTCTTCTTCTCCCGTTTTCACACAGTTGTCTCACCTTTCTCTCAGCCCAGGTCTAGTATCGTT
GAATCTCAGGTCTCGGGTCAACAAAACCCGGAAGCTCGGGTCTAGAGAATCCAACAAATCTAGGAAAATCGTGGCCGTTA
GAGGCTGTTTAGGTTTCGCGAGCTCGAGCCAGTCTGAAGCTCACGTGAGATCACGTGAGCTTGTGTGTAGCGCAAAGAGG
AAAGAGAGCGTGATACAGTTTGTATCCAAGCCGTTAGTTTACGCTTTGTTCTGTATTGCAATTGGATTTTCACCGGTTCG
CTCGTTTCAAGCTCCGGCTTTAGCTCTGCCCTTTGTTAGCGATGTGATACGGAAGAGAAAGAAAGAGACTTTGATTGAAA
AGGAGGTTGTTTTGAAGTCGATTGATCATGAGTTCTCCGGTTATACTCGGAGACTGTTGGAGACGGTTTCGGTTCTTCTC
AAGAGCGTTGAGAAGGTGAGAAAGGAGAACGGAGACGCTGGTGAGGTGGGAGCGGCGTTGGAAGCAGTGAAGGCGGAGAA
GGAGAAGCTTGAGAAAGAGATAATGAGTGGGTTGTATAGTGATTTGAGTCGGTTTAGGAAAGAGAGAGAAGTGTTGATGG
AACGAGCAGATGGGATTGTGGAAGAGGTTCTGAGGTTGAAGAAAGAGAGTGAAAGGATGTTGGGGAAAGGTGATAGGGAG
AAAGCGGAGAGATTGGAAGAGCGTGTGGATGTGATGGAGAGAGAGTACAATAAGATATGGGAGAGAATAGATGAGATTGA
TGATACGGTTTTGAAGAGAGAGACGACGACTTTGAGTTTTGGGGTTAGGGAGCTTATGTTCATTGAAAGAGAGTGTGTGG
AGTTGGTTAAGAGCTTCAACAGAGAAATGAAGCTAAAAAGTTCTGAGAGTATTCCTGAAGGCTCCGTTACGAAACTCACA
AGGTCTGAGATTAAGCAGGAGTTACTGAACGCTCAAAGAAAGCATTTGGAACAAGTGATACTGCCTGATGTTTTGGAACT
AGAGGAGGTTGATCCCTTGTTCGATCGTGATTCAGTGGATTTTTCTCTACGCATCAAAAAACGCCTTGAGGAATCGAAAA
AGCTGCAGAAAGATCTTCAGGATCGTATCAGAGGACGTATGAAAAAGTTTGGTGAAGAAAAGCTTTTTGTTGTAAAAACT
CCAGAAGGTGAAGTTGTCAAGGGCTTTCCTGAAGCTGAGGTGAAGTGGATGTTTGGAGAGAAGGAGGTGGTTGTTCCGAA
AGCTATCCAGCTCCATCTACGCCATGGTTGGAAAAAGTGGCAGGATGAAGCAAAGGCAGATTTGAAACAGAGACTTTTAG
AAGATGTTGATTTTGGTAAACAATATATTGCGCAGAGACAGGAACAAGTTCTCCTGGATCGAGATAGAGTTGTTTCAAAG
ACTTGGTATAATGAAGACAAAGATAGGTGGGAGATGGACCATATGGCTGTTCCATATGCAGTTTCAAGGAAGCTGATTGA
CAGTGCCAGGATTAGGCATGATTTTGCTGTAATGTATGTTGCACTGAAAGGAGATGACAAAGAGTACTACGTTGACCTAA
AGGAATATGAGATGCAATTTGAGAAATTTGGAGGGTTTGATGCTCTGTACCTCAAAATGCTTGCTTGTGGAATCCCAACT
ACTGTTCATCTGATGTGGATACCCATGTCAGAGCTAAGTCTCCATCAACAGTTTCTGCTGTTTACAAGGGTGGTTTCTCG
AGCCTTTACCGCACTGAGGAAGACTCCGATTGTATCACAGGCAAAGGGCATTCTACTAGAGAGAATAAGAAATATAAACG
ATGACCTTATGATGGCGGTCGTTTTTCCAGTTCTTGAATTTATCATTCCTTACCAGCTAAGGCTGCGTCTAGGAATGGCT
TGGCCGGAAGAAATAGAGCAGTCTGTTGGCACAACGTGGTACTTACAATGGCAGTCTGAGGCAGAAATGAACTTCAGGTC
CCGCAATACAGAAGATTTTAAGTGGTTTGTCTGGTTTCTAATTCGAAGTTTTGTGTACGGGTATGTTGTGTATCATGTTT
TCCGATTTCTGAAAAGAAAGATTCCAAGAGTTCTTGGCTATGGACCTTTCCGTCGAGATCCAAACGTGCGGAAATTTTGG
AGAGTGAAATCATATTTTACTTTTAGAAAAAGGAGAATCAAGCAAAAGAGAAAAGCTGGAGTAGACCCTATAAAAACTGC
ATTCGATAGAATGAAGAGAGTGAAGAATCCACCAATCCCACTGAAAAACTTTGCTAGCATTGAGTCTATGAGAGAAGAAA
TCAACGAGGTTGTGGCGTTTTTACAGAATCCGAAGGCATTTCAGGAGATGGGTGCCCGTGCACCACGGGGAGTTCTTATT
GTTGGTGAGAGAGGAACGGGGAAAACGTCACTGGCGCTGGCTATAGCAGCCGAAGCAAGAGTGCCTGTTGTTAATGTTGA
AGCTCAAGAGTTGGAGGCTGGACTATGGGTTGGCCAAAGTGCCGCGAATGTCAGGGAACTCTTTCAAACTGCAAGAGAGT
TGGCACCTGTTATCATATTTGTGGAGGATTTTGATCTCTTTGCTGGTGTACGTGGGAAGCTCATACATACAAAACAGCAA
GATCATGAATCTTTCATTAATCAGCTTCTTGTTGAACTTGATGGTTTTGAGAAGCAGGATGGCGTAGTTTTGATGGCTAC
TACACGAAATCATAAACAGATTGATGAAGCGTTAAGAAGGCCAGGTCGTATGGATAGAATATTTCATCTTCAAAGTCCAA
CTGAAATGGAAAGGGAGAAGATTTTACACAATGCTGCAGAAGAAACCATGGACAGAGAACTCATTGATCTGGTGGATTGG
CGTAAGGTTTCGGAGAAGACATCTCTATTACGACCGATAGAACTGAAACTTGTTCCAATGGCTCTCGAAAGTAGTGCCTT
CAGGAGCAAATTTCTGGACACAGATGAACTTCTCAGTTATGTTAGCTGGTTTGCGACGTTTAGCCGTATAGTGCCCCGAT
GGCTGCGGAAAACGAAAGTTGCCAACAAAATGGGCAAAATGCTAGTTAATCATCTTGGACTCAACTTAACCAAAGAAGAT
TTGGAGAATGTGGTTGATCTGATGGAACCATATGGACAGATAAGCAATGGAATAGAACTTTTGAATCCACCTGTTGATTG
GACGAGGGAGACAAAATTCCCACATGCTGTCTGGGCTGCTGGCCGTGCTCTGATCGCACTTCTAATACCAAACTTCGATG
TTGTAGACAATCTGTGGCTTGAGCCTAGTTCCTGGGAAGGAATTGGGTGCACAAAAATCACCAAGGTCACAAGTGGTGGC
TCTGCAAGTGGGAATACGGAATCAAGATCATATCTTGAGAAGAAGCTCGTTTTCTGCTTTGGATCTCACATTGCTTCCCA
AATGCTTCTTCCTCCTGGAGAAGAAAATTTTCTTTCGTCCTCAGAAATAACGCAAGCGCAAGAGATTGCAACACGCATGG
TGCTTCAGTATGGCTGGGGACCTGATGACAGTCCTGCAGTCTATTATGCCACAAATGCGGTATCAGCTCTGAGTATGGGA
AACCATCACGAATACGAAATGGCTAGTAAAGTCGAAAAGATTTATGATTTAGCGTACGAGAAGGCAAAGGGAATGCTCCT
GAAAAATCGCCGTGTCCTTGAGAAAATCACTGAGGAGCTGCTCGAATTTGAGATACTGACCCATAAGGATCTAGAAAGAC
TTGTTCATGAGAATGGCGGGATTCGGGAGAAGGAACCTTTCTTTCTCTCTGGAACTAGTCACAACGAGCCATTGTCAAAG
AGCTTCCTTGATGCTGGAGATTCTTCAGAAACTGTGCTTCTTAGTACACAAACCTAA