Details for Chinese cabbage Locus Brara.E03452

Position : A05 ( 5`- 27409360 .. 27410520 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03452

Protein [Map View]
MVRLKFACPVLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDKILDVDASSIVI
EIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQIRRPSGRLQGFLRLGVALLDGGQRSMPLSVE
VFDGSRRDSKRDDAKMMHRRTNSDQTDLTTSTNDYGVKTGVVTGGGGSGGGGGGGGGGGVDSMVNGSLCSSDIGPSASVV
AAAIAQGLYNRQKTTVKAVAGKEDASSILEGKTEGIEHRVERWRAEKSAGRAVEAAGSSDDSSGKGGGGRRQRRRRRRRK
EKQRRRNGEGKKGLFSCFGNVFGCEISITCGGGSGGGEGDSTKKKYNNNKVVNLSAVDETFSHSAT*

DNA
ATGGTTCGGCTCAAATTCGCATGTCCGGTCCTCGAAATCAACTTAATCTCAGCACAAGACCTAGCCCCTATCTCAAAAAA
CATGAAAACATACTCAGTCGCGTGGATCAACACCGACCCCATGCGTAAACTCACGACGCGTGTGGACCAAGCAAACCGAG
CTAACCCTATCTGGAACGAGAAGTTCGTGTTCCGCGTAGACGACAAGATCCTCGACGTCGACGCGTCGTCGATAGTCATC
GAGATCTACGCGGCGGCTTGGGCCAAAGACGCGCTCGTCGGGACCGTGAACGTTCTCCTCAGCGACCTCTTCGCTCCTTG
GTCCGGCTTCGGCGACGGCGACGACGGCGGCGGCGGGAACAACAACATGAGGCTCGTGACGCTTCAGATCCGCCGTCCTT
CCGGGAGGCTACAAGGCTTTTTGCGGTTAGGCGTCGCGCTTCTCGACGGCGGTCAGAGGAGTATGCCGTTGTCGGTCGAG
GTTTTTGATGGAAGTCGGAGAGATAGTAAGAGAGATGATGCGAAGATGATGCATCGTCGTACGAATAGCGATCAGACGGA
CTTAACTACGTCGACTAATGATTACGGAGTGAAGACAGGGGTTGTTACTGGAGGAGGTGGTAGTGGTGGAGGAGGAGGAG
GTGGTGGTGGTGGTGGGGTTGATAGTATGGTGAATGGTTCGCTTTGTAGCTCTGATATAGGACCGTCCGCGTCTGTGGTG
GCGGCCGCGATTGCTCAGGGGCTTTACAACAGACAGAAAACAACGGTTAAAGCGGTTGCGGGGAAGGAGGACGCGAGTTC
GATACTAGAAGGGAAGACGGAAGGGATTGAGCATAGAGTTGAGAGGTGGAGAGCGGAGAAAAGCGCGGGCAGAGCGGTTG
AAGCGGCGGGATCGAGCGATGATTCTAGCGGGAAAGGAGGAGGGGGAAGGAGGCAGAGGAGGAGGAGGAGACGGAGGAAG
GAGAAGCAGCGGAGGAGAAACGGTGAAGGTAAAAAAGGGTTGTTCTCGTGCTTTGGAAACGTGTTCGGATGTGAGATTTC
GATTACTTGCGGCGGTGGGAGCGGCGGAGGAGAAGGAGACAGCACGAAGAAGAAGTATAATAACAATAAAGTAGTCAATC
TTAGTGCTGTAGACGAAACGTTTAGTCATTCTGCGACTTGA