Details for Chinese cabbage Locus Brara.E03450

Position : A05 ( 5`- 27402615 .. 27404981 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03450

Protein [Map View]
MQPLILTDERVRKACETTRELKIPDEKTLSVLKKLLQENGENWTLIKLDNYTALIDAIYSLDEEQEEEEEDKKKNETLSN
GTRGKHVFDSPPSGALKKQGKNVVVGTDSPATLKRKYETRSAASGSSTEEAQKHPSNGVVRKKKYKTIIRDITKGSESVE
ISLVDEVGTEQVPKFTYIPHNIVYQSAYVHVSLARISDDDCCASCKGDCLSADFPCACARETGGEYAYSKDGLLKEEFLD
TCLKMKKAPDSFSKFYCQDCPLERDDGKCEGHLIRKFIKECWRKCGCDMMCGNRVVQRGIRCQLQVYFTQEGKGWGIRTL
QDLPKGTFVCEYIGEILTNTELYDRNIRSTSERHTYPDLKDEEALCLDATVCGNVARFVNHRCEDANLIDIPVQIETPDR
HYYHIAFFTIRDVKAMDELTWDYLIDFHDESHPVKAFRCCCGSELCRDKKPKGSGGKSGERRKAVPAKKQAGSKAMALKR
K*

DNA
ATGCAGCCTTTGATTCTCACTGACGAGAGAGTACGCAAAGCTTGTGAGACAACAAGAGAACTAAAAATCCCCGATGAGAA
GACACTCTCAGTGCTTAAGAAGCTTCTCCAAGAGAACGGTGAGAATTGGACTCTCATCAAACTTGATAACTACACCGCAT
TGATCGACGCTATCTACTCTCTCGACGAAGAACAAGAAGAAGAAGAAGAGGATAAGAAAAAAAACGAAACTTTATCTAAC
GGCACTAGAGGGAAGCATGTCTTTGACTCTCCTCCTAGTGGTGCTCTGAAGAAGCAAGGGAAGAATGTTGTTGTGGGCAC
TGACTCTCCTGCTACTCTGAAAAGAAAATACGAAACCCGTTCCGCAGCCTCAGGCTCGTCCACTGAGGAAGCTCAGAAGC
ATCCTAGCAACGGTGTTGTTCGCAAGAAGAAGTATAAAACGATTATTCGTGACATCACGAAAGGCTCAGAGAGCGTTGAG
ATATCTCTGGTTGATGAGGTTGGGACTGAGCAAGTCCCCAAGTTTACTTACATCCCTCACAACATTGTTTACCAAAGTGC
TTATGTCCATGTGTCTCTGGCTAGAATTTCTGATGACGATTGTTGCGCGAGCTGTAAGGGGGACTGTCTTTCAGCGGACT
TTCCGTGTGCTTGTGCTCGTGAAACCGGCGGAGAGTATGCGTATAGTAAAGATGGGTTGTTAAAGGAGGAGTTTTTGGAT
ACTTGTCTTAAGATGAAGAAGGCGCCTGATAGCTTCAGTAAGTTTTACTGCCAAGACTGCCCTTTGGAGAGAGATGATGG
GAAGTGTGAAGGACATTTGATTAGGAAGTTTATTAAGGAGTGTTGGAGAAAGTGTGGATGTGATATGATGTGTGGGAATC
GAGTGGTGCAGAGAGGGATAAGGTGCCAACTCCAGGTTTACTTTACCCAAGAAGGGAAAGGATGGGGTATTAGAACACTG
CAAGACTTGCCGAAAGGAACCTTTGTTTGTGAATATATTGGTGAAATATTGACCAATACGGAGTTGTACGATCGGAATAT
AAGATCTACTAGTGAACGGCATACATATCCTGATTTGAAAGATGAAGAAGCTCTCTGCCTGGATGCCACAGTCTGTGGAA
ATGTCGCTAGATTTGTCAATCACAGATGTGAGGATGCAAACTTGATTGATATTCCGGTACAAATAGAGACTCCTGACAGA
CATTATTATCATATTGCCTTTTTTACCATTCGAGACGTGAAGGCCATGGATGAACTGACATGGGATTACTTGATAGATTT
CCATGATGAAAGTCATCCCGTGAAGGCATTTAGATGTTGCTGCGGAAGCGAATTATGCAGAGACAAAAAGCCAAAAGGAT
CTGGAGGCAAGTCAGGAGAAAGAAGAAAGGCTGTTCCTGCTAAAAAACAAGCAGGTTCCAAAGCGATGGCATTAAAAAGA
AAATGA