Details for Chinese cabbage Locus Brara.E03442

Position : A05 ( 5`- 27369010 .. 27370917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03442

Protein [Map View]
MSIPPSSASSSSSSSASQYTYTANSYYSAPYQPPQPFVAPSPPPVATIPGATVYPQPIGPVPAVYSYPQYQAHQLFQRDA
QTITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLAEWPENDYRLFCGDLGNEVNDDVLSKAFARFPTFN
MAKVIRDKRTGKTKGYGFVSFLNPADLAAALKEMNGKYVGNRPIKLRKSSWKERTDQEAAERQKHHSNKKQKTVKKKSVL
HK*

DNA
ATGTCAATCCCGCCGTCTTCAGCTTCTTCTTCATCTTCATCTTCAGCCTCTCAGTACACATACACTGCGAATTCGTACTA
TTCCGCGCCTTACCAGCCTCCACAGCCCTTCGTGGCGCCGTCGCCTCCTCCGGTTGCTACCATTCCCGGAGCTACGGTCT
ATCCTCAGCCTATTGGCCCCGTTCCCGCCGTGTACTCTTACCCTCAGTACCAGGCGCATCAGTTGTTCCAGAGAGATGCA
CAAACCATCACACCAGAAGCGCTTGAGAATGTGAAAGCTGCTTTGGCTAGTAGCGAAACGGAACACAAGGCGGAAACTAA
GAAGAGAGCTATTCCTCGTAAAGCTGCTGGGCAGTCTTGGGAGGATCCTACTCTTGCAGAGTGGCCTGAAAATGACTATC
GCTTGTTTTGTGGTGATCTTGGGAATGAAGTAAATGATGATGTTCTTTCCAAGGCATTTGCTCGGTTCCCCACCTTCAAT
ATGGCCAAGGTCATCAGAGACAAGCGGACAGGTAAAACCAAGGGTTATGGATTTGTGAGTTTCTTAAATCCTGCGGATCT
AGCTGCAGCCCTAAAAGAAATGAATGGTAAGTATGTTGGGAATCGTCCAATCAAATTAAGAAAGAGCAGCTGGAAAGAGA
GAACAGATCAGGAGGCTGCAGAAAGACAAAAGCATCATAGCAATAAGAAACAAAAGACAGTGAAGAAGAAGAGCGTACTC
CACAAGTGA