Details for Chinese cabbage Locus Brara.E03438

Position : A05 ( 5`- 27352920 .. 27355033 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03438

Protein [Map View]
MTDNIFEGLPPPSSQHQELPNSSNPDESPSPAPTLVLKSSLKRSKPPESAPDASAPPVLKSALKRSKPGPEPEPEAPKKR
LQFKTSTDASEEQVVEAMQKITSHIKNPSKFSKASKLAIRLIQAGSVKAETSCYLIAMLEAAMSSKTPCTDRLVRGDYHA
LFSAAQDVAECLDKSQKNLLTIWTIKAVVANDLFTDDSFMFSKTATQIKEAISDLPVATEEDDAEEAAALEQEAVKDSGD
GETTQDVDEAASAGGQEDVESDPFGLDAWIPSHVKKNGKRKMTKEDTDALENKKFLRSKREALITCLEIAARRYKVPWCQ
TVIDILVKHAFENASRFTSQQRRAVEKLWASVREQHLRRKQGKSVTGKLDVTAFESLQDKYANEKMSIRRSVGANGERRA
QQWLG*

DNA
ATGACGGATAATATCTTCGAAGGTCTACCTCCTCCGTCTTCTCAACATCAAGAGCTTCCCAATTCTTCAAATCCAGACGA
AAGCCCCTCCCCAGCTCCGACTCTGGTTCTCAAAAGCTCCCTGAAGCGATCTAAACCACCAGAATCAGCACCCGATGCCT
CAGCTCCTCCTGTTCTCAAGAGCGCACTAAAGCGTTCAAAACCAGGACCTGAACCAGAACCTGAAGCTCCTAAGAAGCGT
CTACAGTTCAAGACATCGACGGATGCATCAGAAGAGCAAGTGGTGGAAGCGATGCAGAAGATAACGTCTCACATCAAGAA
CCCTTCAAAATTCTCCAAAGCCTCGAAGCTCGCCATACGCCTGATTCAAGCTGGAAGCGTGAAGGCGGAAACTAGCTGTT
ACTTGATTGCGATGCTCGAAGCTGCTATGTCGTCGAAAACTCCTTGTACTGATCGCTTGGTTCGAGGAGACTACCATGCT
TTGTTCTCAGCAGCTCAGGATGTCGCCGAGTGCCTTGATAAAAGCCAGAAGAATCTGTTGACTATTTGGACGATTAAAGC
AGTTGTGGCTAATGACCTCTTTACTGATGACAGCTTTATGTTTTCCAAGACTGCTACTCAGATAAAGGAGGCTATATCTG
ATCTTCCTGTAGCAACTGAGGAAGATGACGCTGAAGAAGCAGCTGCTCTTGAACAAGAGGCTGTGAAGGACAGTGGAGAT
GGGGAGACAACACAGGACGTGGATGAAGCTGCTTCAGCTGGAGGTCAAGAGGATGTTGAGTCTGATCCCTTTGGGCTCGA
TGCATGGATCCCCAGTCACGTGAAGAAAAATGGTAAAAGAAAGATGACCAAAGAAGACACAGATGCCTTGGAGAACAAGA
AATTTCTCAGGTCGAAAAGAGAAGCTTTGATTACATGCCTGGAGATCGCTGCACGCCGTTACAAAGTCCCATGGTGTCAG
ACTGTTATAGACATATTGGTGAAACACGCGTTTGAGAACGCGTCGAGGTTCACATCGCAGCAGAGACGAGCGGTGGAGAA
ACTGTGGGCTTCTGTTCGAGAACAACATTTACGTAGGAAGCAAGGCAAGTCAGTGACGGGGAAGCTCGACGTTACTGCTT
TCGAAAGTCTTCAGGATAAATACGCCAACGAGAAGATGAGCATCCGGAGATCTGTTGGAGCTAACGGTGAACGCCGTGCA
CAGCAATGGCTTGGTTGA