Details for Chinese cabbage Locus Brara.E03433

Position : A05 ( 5`- 27319125 .. 27320909 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03433

Protein [Map View]
MEEVEAASKLAIESCHGVLNLLSQHQTSSGSKSLMVETRETVSKLKRVASLLTKGSGHGKFKRTNNNKFSPSFPQHIFLE
SPICCGNDVSSDYTQVLAPEPLQMVPASDEIDPRYQLGHPLSHRWPPPFRAPYKQIAYSRSNSGGVNLTFDGSASSCYTP
SVSNGSRSFVSSLSMDTSVDRSSFQLTGLSRVKMCSGSLKCGSRSKCHCSNKRKLRVKRSIKVPAISNKIADIPPDEYSW
RKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDETSMLIVTYEGEHNHSRILSSQSAHT*

DNA
ATGGAGGAAGTTGAAGCTGCTAGCAAGTTAGCTATAGAAAGCTGTCATGGAGTCTTGAACCTCTTGTCACAACATCAAAC
CAGCAGTGGTTCCAAATCTCTCATGGTTGAAACTAGAGAAACAGTTTCCAAGCTCAAGAGAGTAGCCTCTCTTTTAACCA
AAGGGTCAGGTCATGGTAAGTTTAAAAGAACCAACAACAACAAGTTTAGTCCATCTTTCCCTCAGCATATCTTCTTGGAG
AGTCCTATTTGCTGTGGCAATGATGTGAGTAGTGATTACACTCAAGTTCTTGCACCTGAGCCTCTTCAGATGGTTCCAGC
TTCTGATGAGATTGACCCAAGATACCAATTGGGTCACCCACTTAGCCACAGATGGCCACCGCCTTTTCGAGCTCCTTACA
AGCAAATAGCTTACTCTAGAAGCAACAGCGGTGGTGTAAACCTGACGTTTGATGGGTCTGCTAGTAGTTGCTATACCCCG
AGTGTATCAAACGGATCAAGATCTTTTGTATCATCTCTTAGTATGGATACTAGCGTCGATAGGAGCTCGTTCCAGTTAAC
CGGATTATCACGTGTGAAGATGTGCTCTGGTAGTTTGAAATGCGGAAGTAGAAGCAAATGTCACTGTTCCAACAAGAGGA
AACTTAGAGTGAAAAGATCAATCAAGGTGCCTGCAATCAGCAACAAGATTGCGGATATTCCTCCAGATGAGTATTCATGG
AGGAAGTATGGTCAGAAACCTATCAAAGGCTCACCGCATCCACGGGGATACTACAAGTGCAGCAGTGTGAGAGGTTGTCC
GGCGAGGAAGCATGTGGAGCGATGTGTAGATGAAACTTCGATGTTAATTGTGACTTACGAAGGTGAGCATAACCATTCAA
GGATATTGTCTTCGCAATCAGCTCACACATGA