Details for Chinese cabbage Locus Brara.E03431

Position : A05 ( 5`- 27315510 .. 27316498 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03431

Protein [Map View]
MDNSFNLADLDCSRKSDLGSGARVQGASALNIRATYHFYNPEQNNWDLMAVRNVMTNAVVTVRIGDLFKRLDNDGVGYEQ
GQLIVDYEFVDCDDELINQPGHS*

DNA
ATGGATAATTCTTTTAATTTAGCAGATCTGGATTGTAGCCGGAAGTCAGACTTGGGAAGCGGGGCTAGGGTCCAAGGAGC
TAGTGCGTTGAACATACGCGCCACCTACCATTTCTATAACCCTGAGCAGAATAACTGGGATCTGATGGCCGTGAGGAACG
TCATGACGAATGCAGTAGTAACGGTGAGAATAGGGGACCTTTTCAAAAGATTGGATAACGATGGTGTTGGCTATGAGCAA
GGTCAACTCATTGTTGACTATGAATTTGTTGACTGTGACGATGAACTAATTAATCAGCCTGGTCATTCTTAA