Details for Chinese cabbage Locus Brara.E03428

Position : A05 ( 5`- 27298173 .. 27298433 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03428

Protein [Map View]
MSNLKGTSRGMVVAILIAACVFMLSNIATGKFIGYPPIDRGDNPPGCDPNYPGSCQPPQPANPYKRGCTIGSRCKRVPPL
PPKINI*

DNA
ATGAGCAATCTAAAAGGAACAAGCAGGGGTATGGTCGTTGCAATACTCATAGCAGCATGTGTGTTTATGCTCAGCAACAT
AGCGACTGGAAAATTCATTGGATATCCACCAATAGATCGTGGCGATAATCCTCCTGGATGTGATCCTAACTACCCTGGCT
CGTGTCAACCCCCGCAACCAGCAAATCCGTACAAACGAGGATGTACGATCGGGTCAAGATGTAAACGTGTCCCGCCACTT
CCTCCTAAAATCAATATCTAG