Details for Chinese cabbage Locus Brara.E03427

Position : A05 ( 5`- 27290544 .. 27297431 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03427

Protein [Map View]
MAELGQQTVDFSALVGRAAEESFLSLTELVEKAKSPELSDTEKKLSLLKYVVKTQQRMLRLNALAKWCKQVPLINRLQDV
GSTLSAHDICFTQAADSLFFMHEGLQQARAPVYDVPSAIEVLLTGSYQRLPKCVDDVGMQCSLDEHQQKPALRKLEVLVR
SKLLEITLPKEITEVKVSKGTVTLSVEGEFKVLVTLGYRGHLSMWRILHLDLLVGERSGGPIKLEVTRRHILGDDLERRM
SVAENPFTILYAVLHELCVAIVMDTVIRQVRTLLHGRWKDAIRFDLISDTGTAPANQEGEADSVSLKTPGVKLMYWLDSD
KNNAGSFVKIEPGSDLQIKCSHSTFAIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRSDRICRAPS
DVILQAFLDEPGSEGSSMVDSKEQKEPEVLRVRAYGSSFFTLGINIRTGKFLLQSSKSVLTPSILVEFEDALNQGSISAV
DAFINLRSKSILHFFAAIGKFLGLEVYEHGFGVNKAPKSLSDGSSILALGFPDCESSHLLLMELEKDFTPLFKLAETQTD
GSGKPQFLNDLSNVLRVKKIDIGQIRILEDDLNLITSDVASFVSSFSDAERSLSQASGHRGPGLVEESLAEMSGGQLSFS
SIVDEVFGHQKVTSSADGKAPLLTSYQSDSFYSMQGPLESSSFNLLSSPPPGKGSAMKKNSNQELSMVLSPSRTVVSESA
DLAVTSDGPLLRKDQKSRKRSASDLLRLIPSLQGVEGVTHPNKRSKTSASQALSTAVVTSAKTVGCSYGDLIAEANKGNA
PSSVFVYALLHVVRHSSLSIKHAKLTSQMEALDIQYVEEMGLRDSFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKI
NDQHFRDLWELQKGSKSTPWGSGVHIANSSDVDSHIRYDPEGVVLTYQSVEADSIKKLVADIQRLSNARRFSLGMWKLLG
IKADEKTEEPGGANPAVKGPTGGKGGGEAVDRWRAFKIEAVGLTSLWFSFGSGIMARFVVEWESGKDECTMHVSPDQHWP
HTKFLEDFINGGEVESLLDCIRLTAGPLTALAAATRPARASSATGVTVVPATATSRQSNQTQQTQPSTLAAPNAVGQSAS
GSALASPSPAPSPLGGSFHGAAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGG
ASIGGSLPCPQFRPFIMEHVAQELNGLEPNLTGSQGGATNPNSGSRVNFSPSSVMSRAVMSRVGSVASGSLVAGSGLSVR
RPLGSGVPAHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKENEGALLNL
DQEQPALRFFVGGYVFAVSVHRVQLLLQVLSVRRFHHQQQQQNGSSGTAQEELTQSEIGEICDYFSRRVASEPYDASRVA
SFITLLTLPIPVLREFLKLIAWKKGLSQSQQAGEVAPAQRPRIELCLENHSGADVETSCAAKSNIHFDRPQSTVDFALTV
VLDPAHIPHINAAGGAAWLPYCVSVRLRYTFGDNPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLT
QGKLKLVADSVQRTLHLCLQGLSSNNTLQKEFTI*

DNA
ATGGCGGAATTAGGGCAACAGACGGTGGATTTCTCCGCCCTCGTTGGTCGAGCCGCGGAGGAATCGTTCCTCTCCCTCAC
GGAGCTCGTTGAGAAGGCCAAGTCGCCGGAGCTCTCCGATACTGAGAAGAAGCTCAGCCTCCTCAAGTATGTCGTCAAGA
CTCAGCAGCGGATGCTTCGGCTCAATGCCCTCGCCAAGTGGTGTAAACAGGTTCCTCTGATAAACCGCTTGCAGGACGTT
GGGAGCACACTATCAGCTCACGATATATGCTTCACACAAGCTGCGGATTCACTCTTCTTCATGCACGAAGGTCTCCAGCA
AGCTCGTGCCCCCGTCTACGACGTCCCCTCCGCTATTGAAGTCTTGCTGACAGGCTCTTACCAGCGCCTCCCAAAGTGCG
TAGACGATGTGGGGATGCAGTGCTCTTTGGACGAGCACCAGCAGAAGCCAGCGCTGAGAAAGCTGGAGGTGCTCGTACGT
TCCAAACTACTCGAGATCACGCTTCCAAAAGAGATCACAGAGGTCAAAGTCTCTAAAGGCACGGTTACCTTATCCGTGGA
GGGGGAGTTCAAGGTTCTGGTGACTCTCGGTTACCGAGGACACCTGTCCATGTGGAGGATACTGCATTTGGATCTCCTCG
TTGGTGAGAGAAGCGGTGGTCCGATTAAACTAGAGGTGACAAGACGGCATATCCTCGGTGATGATCTAGAGCGTAGAATG
TCAGTTGCGGAGAATCCATTCACTATACTATACGCGGTGCTCCATGAGCTTTGCGTCGCCATTGTCATGGACACAGTCAT
AAGGCAGGTCAGAACTCTTCTCCACGGGAGATGGAAAGACGCGATTCGGTTTGACTTGATCTCGGACACCGGCACAGCAC
CAGCAAACCAAGAAGGAGAGGCAGATTCTGTTAGTCTCAAAACGCCAGGAGTGAAGCTAATGTACTGGCTAGATTCTGAT
AAAAATAATGCTGGCTCGTTCGTTAAAATCGAGCCGGGGTCAGATCTTCAGATTAAGTGCTCTCACAGCACGTTTGCGAT
TGACCCGCTGACCGGCAAGGAAGCTGAGTTTTCTCTGGATCAGAGCTGCATTGACGTGGAGAAGCTTCTACTTAAAGCTA
TTTGCTGTAATAGATACACCCGTCTTCTTGAGATTCAGAAAGAGCTTTTGAGGAGTGACAGGATTTGTCGAGCTCCCAGT
GATGTCATCCTGCAGGCCTTCCTGGATGAGCCTGGCAGTGAGGGAAGTAGCATGGTAGATTCTAAGGAACAAAAAGAGCC
AGAGGTATTACGCGTCCGAGCTTATGGATCATCATTTTTCACACTCGGGATCAATATAAGGACCGGTAAGTTTCTTCTTC
AGTCATCCAAGAGTGTCTTGACCCCCTCCATCTTGGTCGAGTTTGAAGATGCGTTGAATCAAGGGAGTATATCTGCTGTT
GATGCCTTTATCAACTTGAGAAGCAAAAGCATTTTGCATTTTTTTGCCGCCATTGGCAAATTTTTGGGTCTTGAAGTCTA
CGAACATGGTTTTGGCGTAAACAAAGCCCCCAAAAGCCTCTCGGATGGGTCAAGCATCCTGGCGTTGGGATTCCCTGACT
GTGAAAGCTCTCACCTCTTGCTCATGGAGCTCGAAAAGGACTTCACGCCGTTGTTTAAATTAGCGGAAACTCAAACGGAC
GGTTCGGGGAAGCCTCAGTTTCTCAACGATCTGAGCAACGTTCTGCGTGTTAAGAAGATTGATATTGGGCAGATACGGAT
TCTTGAAGATGATCTCAACTTGATCACATCGGATGTAGCTAGCTTTGTATCTTCGTTCTCAGATGCTGAGAGGAGCTTGA
GTCAAGCGTCTGGACACCGTGGTCCTGGATTAGTTGAGGAGTCTTTGGCGGAGATGAGTGGAGGCCAGTTGAGTTTCTCT
AGCATCGTAGATGAAGTGTTTGGACATCAGAAAGTGACGTCATCCGCTGATGGAAAAGCTCCGTTGTTGACTAGCTATCA
ATCAGATTCCTTCTACAGTATGCAAGGCCCTTTAGAATCTAGCTCTTTTAATCTGTTGTCATCTCCTCCCCCTGGGAAGG
GTTCAGCTATGAAGAAGAACTCTAACCAGGAGTTGTCCATGGTATTGTCTCCATCCCGAACTGTTGTCTCTGAGTCAGCT
GATCTTGCAGTTACCTCTGATGGTCCTTTGTTGAGAAAAGACCAGAAGTCACGGAAACGTTCAGCCTCAGATTTGCTGAG
ATTGATCCCATCTCTACAAGGAGTGGAAGGTGTGACTCATCCCAATAAGAGAAGTAAAACCTCTGCATCACAGGCCCTAT
CTACTGCAGTGGTAACATCAGCAAAAACCGTAGGATGCAGCTATGGGGATCTCATAGCTGAAGCAAACAAAGGGAACGCA
CCTTCGAGCGTTTTCGTCTACGCTCTTCTTCACGTGGTCAGGCACTCTTCTTTGTCCATAAAGCACGCCAAGCTAACTAG
TCAGATGGAGGCACTGGACATCCAATACGTTGAGGAGATGGGACTGAGAGATTCGTTTTCAGACATATGGTTCCGTCTTC
CGTTTGCTCAAAACGATTCCTGGCAGCACATATGCTTGCAGCTCGGTAGACCCGGGAGCATGTGCTGGGATGTGAAAATA
AACGACCAGCACTTCAGGGATCTCTGGGAGCTTCAGAAGGGAAGCAAATCAACACCGTGGGGATCCGGAGTTCACATTGC
GAACTCGTCTGATGTTGATTCACATATCCGTTATGACCCTGAGGGAGTTGTTCTGACCTATCAGTCCGTGGAAGCCGATA
GTATCAAGAAGCTTGTGGCGGATATACAGAGGCTTTCGAATGCCAGAAGGTTCTCCCTTGGTATGTGGAAACTACTTGGC
ATAAAGGCGGATGAGAAAACAGAAGAGCCTGGTGGTGCTAATCCCGCTGTTAAAGGACCTACTGGAGGGAAAGGCGGTGG
TGAGGCGGTTGATAGATGGAGGGCTTTCAAGATTGAGGCAGTGGGATTAACGAGCCTGTGGTTTAGCTTTGGTTCGGGCA
TTATGGCTCGTTTTGTTGTGGAGTGGGAATCAGGGAAAGATGAATGCACCATGCACGTCTCTCCTGACCAGCACTGGCCA
CATACTAAGTTCTTGGAGGATTTCATAAATGGTGGAGAGGTAGAATCTCTTCTGGATTGCATTCGCCTTACTGCTGGGCC
TTTGACTGCGTTAGCTGCCGCTACTCGCCCTGCCCGAGCTAGTTCAGCCACTGGCGTGACTGTCGTACCTGCTACAGCGA
CTTCAAGACAATCAAATCAGACGCAACAAACTCAACCTTCAACTTTAGCAGCTCCTAATGCTGTTGGCCAGTCTGCCTCA
GGGAGTGCTCTTGCTTCTCCTTCTCCTGCTCCAAGTCCACTCGGTGGAAGTTTCCATGGAGCTGCAGGGAGAAGCGGACC
TGGAATCGTTCCCAGCTCTCTCTTACCCATTGATGTCTCTGTAGTACTCCGTGGACCCTATTGGATAAGGATCATATACC
GCAAACGTTTTGCGGTGGACATGAGATGCTTTGCTGGAGATCAAGTCTGGTTGCAACCGGCAACTCCACCCAAGGGCGGT
GCTTCTATCGGAGGCTCCTTGCCATGTCCCCAGTTCAGACCTTTCATCATGGAGCATGTTGCTCAAGAGTTAAACGGTTT
AGAACCGAATCTGACAGGTAGCCAAGGAGGAGCAACAAATCCAAACAGTGGTAGCAGAGTTAACTTTTCCCCTTCTAGTG
TAATGTCAAGAGCCGTGATGAGTCGTGTAGGCAGTGTTGCTTCAGGATCTTTAGTGGCTGGCTCAGGGTTGTCTGTACGT
AGACCACTAGGGAGCGGTGTGCCAGCACATGTAAGAGGCGAGTTAAACACAGCGATCATCGGTTTAGGTGATGATGGTGG
CTATGGCGGTGGATGGGTTCCTCTTGTGGCTCTTAAAAAAGTTTTGCGTGGCATCCTCAAATATCTTGGAGTACTTTGGC
TATTTGCTCAGCTTCCAGATCTCTTGAGAGAGATCTTAGGTTCAATCTTGAAGGAGAACGAAGGCGCTCTCTTGAATCTA
GACCAAGAACAACCAGCGTTACGCTTCTTTGTCGGTGGCTATGTATTTGCGGTGAGTGTCCATAGAGTTCAGCTTCTTCT
TCAAGTCCTTAGCGTAAGGAGATTCCATCACCAGCAACAGCAGCAAAACGGTTCATCAGGTACTGCTCAAGAGGAGCTAA
CACAATCCGAGATTGGAGAAATCTGTGACTACTTCAGCCGTCGTGTTGCATCAGAGCCTTACGATGCTTCGAGAGTCGCC
TCGTTCATAACACTCCTCACACTACCTATACCTGTCTTAAGAGAGTTTCTTAAACTGATAGCTTGGAAGAAAGGTCTATC
GCAATCACAACAAGCTGGAGAGGTTGCTCCTGCGCAGAGACCTAGAATCGAGCTATGCCTAGAGAACCATTCGGGTGCAG
ATGTGGAAACCAGCTGTGCAGCTAAAAGCAATATCCATTTCGACCGGCCTCAGAGTACGGTTGACTTTGCTCTGACCGTT
GTTCTTGATCCTGCGCACATACCTCACATCAACGCAGCTGGAGGAGCGGCGTGGCTGCCTTACTGTGTATCGGTTAGGCT
AAGGTACACCTTTGGGGATAACCCTAGCGTGACGTTTCTTGGGATGGAAGGAAGCCATGGAGGAAGGGCTTGTTGGCAGC
GTGTTGATGATTGGGAGAAGTGTAAACAGAGAGTGAGCCGTACGGTGGAAGTCAACGGTTCTGCCGCAGGGGATTTGACT
CAAGGGAAGCTCAAATTGGTTGCAGATAGTGTCCAGAGAACATTGCATCTATGTCTTCAAGGTCTCAGTAGTAATAACAC
TCTTCAAAAGGAGTTTACCATATAG