Details for Chinese cabbage Locus Brara.E03426

Position : A05 ( 5`- 27288388 .. 27290343 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03426

Protein [Map View]
MFVRRGVRFFATECKRKTTTWDPLHSLDLNHPSLVLLEKCNSRHQFKQILANIMRVNLICDTFPMSRLILFSAITYPGNI
DLAKLLFRNFTPNPNVFVYNTMISSTVSKKECFGLYGSMIRHSVCPDRQTFLYLMKVTNFVSELKQIHCHVTVSGVLSEG
NNYYLWNSLVKVYMEFGDLGYAEKVFDEMPERDVSSFNTMIVGYAKKGYCLEAMKVYYKMVGDGIEPDEYAVLGLLVCCG
RLSDVRLGKGVHGWIERRKPGSSSNLILWNAVLDMYFKCRESGLAKRVFDMMAKKDTCSWNTMVGGFVKLEDMEAARDVF
DQMPRRDLVSWNSLLLGYSKKGCDQMAVRELVYEMLIVEKVVPDRVTMVSLISGAANNGELSQGRWAHGLVIRLGLQVDA
FLGSALVDMYCKCGSIERAFKVFKTVAEKDVTLWTTMISGTAFHGNGKQALELFEEMQEEGVKPNKVTLLAVLTACSHSG
LVEEGLHVFNHMKEAFGFDPETEHYGSLVDLLCRAGRVEEAKDIVLKKMPMRPSQSMWGSILSACRGKEDVETAEMALTE
LVKLEPDKEGGYVLLSNIYAAARRFGYSDKTREAMESRGVKKVAGYSSVVGVEGVHSFVATEKQNHPRWLEIRRILHHLC
EEMSSNLDLIH*

DNA
ATGTTCGTGCGTCGAGGAGTTCGTTTCTTTGCTACCGAATGTAAACGCAAGACGACAACATGGGATCCTCTTCACTCCCT
CGACCTCAATCACCCATCTCTTGTTCTGCTCGAGAAATGCAACTCCAGGCACCAATTCAAGCAGATCTTAGCAAACATCA
TGCGCGTCAATCTCATATGCGACACGTTTCCCATGAGCCGTCTCATCTTGTTCTCAGCGATTACGTATCCAGGCAACATC
GACTTGGCTAAGCTTCTGTTTCGTAACTTCACACCGAACCCAAACGTTTTCGTTTACAACACAATGATCTCTTCTACTGT
TTCCAAGAAGGAATGTTTTGGTCTTTACGGGTCTATGATTAGACACAGTGTTTGTCCTGATAGGCAGACGTTTCTGTACT
TGATGAAAGTAACGAACTTTGTGTCGGAATTGAAGCAGATTCATTGTCACGTAACTGTTTCTGGGGTTTTGTCTGAAGGG
AATAATTATTACCTGTGGAACTCTCTGGTGAAAGTTTATATGGAGTTTGGAGATTTGGGTTATGCAGAGAAGGTGTTCGA
TGAAATGCCTGAACGAGATGTTAGTTCTTTCAACACGATGATTGTTGGTTATGCTAAGAAGGGGTATTGTTTAGAGGCGA
TGAAGGTGTATTATAAGATGGTTGGTGATGGTATTGAGCCTGACGAGTACGCGGTGTTGGGTCTTTTAGTTTGTTGTGGT
AGATTGTCTGATGTTAGGCTTGGGAAAGGAGTTCATGGTTGGATTGAGAGGAGGAAGCCTGGCTCTTCGTCGAATTTGAT
ACTGTGGAATGCTGTTTTAGATATGTATTTCAAATGCAGAGAGTCTGGTCTTGCGAAAAGAGTGTTTGATATGATGGCGA
AGAAGGATACGTGTTCTTGGAACACTATGGTTGGTGGCTTTGTTAAGCTTGAGGACATGGAAGCTGCTCGTGACGTTTTT
GATCAGATGCCTAGAAGAGATCTTGTCTCTTGGAACTCTCTGCTTCTTGGTTACTCCAAGAAGGGGTGTGATCAGATGGC
TGTGAGAGAATTGGTCTATGAGATGTTGATAGTGGAGAAGGTTGTTCCAGACCGCGTCACTATGGTAAGTTTGATTAGTG
GTGCAGCAAACAACGGAGAACTTAGCCAAGGAAGATGGGCACACGGGTTAGTGATCCGTCTGGGATTGCAGGTTGATGCC
TTTCTTGGTTCGGCTCTGGTGGATATGTACTGCAAGTGTGGTAGCATCGAGAGAGCTTTCAAGGTTTTCAAAACAGTTGC
TGAAAAGGACGTCACGCTATGGACAACGATGATATCCGGGACTGCCTTCCATGGGAATGGCAAGCAAGCTCTGGAACTAT
TCGAAGAAATGCAAGAAGAAGGCGTGAAGCCGAACAAAGTCACTCTCCTCGCTGTCCTAACGGCTTGCAGCCATAGCGGC
CTAGTGGAGGAAGGGTTACACGTTTTCAACCACATGAAGGAGGCATTCGGGTTTGACCCTGAAACCGAGCATTACGGAAG
CCTTGTGGATCTCTTGTGTCGGGCGGGGAGAGTAGAAGAAGCGAAAGACATAGTGCTAAAGAAGATGCCAATGAGACCAA
GTCAGTCAATGTGGGGATCGATCTTAAGCGCTTGTCGGGGAAAAGAAGATGTCGAAACTGCAGAGATGGCTTTAACGGAG
TTGGTCAAGTTGGAGCCTGACAAAGAAGGTGGATACGTGTTGCTGTCCAACATCTATGCAGCCGCTAGAAGATTTGGATA
TTCAGACAAGACGAGAGAAGCGATGGAGAGCCGTGGAGTAAAGAAGGTTGCAGGATACAGTAGTGTAGTAGGAGTAGAGG
GAGTTCATAGCTTTGTGGCTACAGAGAAGCAGAACCATCCAAGATGGCTTGAGATTAGAAGAATATTGCATCATCTATGT
GAAGAAATGAGTTCAAACTTGGATCTTATTCATTAA