Details for Chinese cabbage Locus Brara.E03423

Position : A05 ( 5`- 27279352 .. 27280877 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03423

Protein [Map View]
MSAESASDIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALTQGYREDAGLNLESDADEQLLIYIPFNQVVKLHSFAIKGP
EDEGPKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEDNQSGSEVTKVQKIALYGS
TVETTDMKGLKKIEDH*

DNA
ATGTCCGCCGAATCAGCCAGCGATATTCCTAAGGGACAGGTTGATCTGCTAGATTTCATTGACTGGTCTGGTGTTGAATG
CCTCAACCAAAGCTCGAGTCACTCCTTGCCCAATGCCCTCACACAGGGGTATAGAGAAGATGCGGGGTTGAACCTAGAGA
GTGATGCTGATGAACAGCTACTAATCTATATTCCTTTTAACCAAGTTGTCAAACTACATTCTTTTGCTATCAAAGGCCCC
GAAGATGAAGGTCCTAAAACAGTGAAGTTTTTCTCAAACAAAGAACACATGTGCTTCAGCAATGTCAATGATTTTCCACC
AAGTGACACTGCTGAACTAACCGAAGAAAACCTTAAGGGAAAACCGGTGGTCCTTAAATATGTTAAGTTTCAGAATGTTC
GTAGCTTAACGATCTTCATTGAAGACAACCAATCGGGTTCTGAGGTCACAAAGGTTCAGAAGATCGCTCTTTACGGCTCA
ACGGTTGAGACTACTGATATGAAGGGGTTGAAAAAGATTGAAGATCACTGA