Details for Chinese cabbage Locus Brara.E03419

Position : A05 ( 5`- 27259562 .. 27261567 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03419

Protein [Map View]
MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHA
YRKIRLRAEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQ
IRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDV
GVKVDRPADETAAEEPTEIIGA*

DNA
ATGGCCGTTGGGAAGAACAAGAGAATCTCTAAAGGAAGAAAGGGAGGGAAGAAGAAGATTGTTGATCCTTTCTCCAAGAA
GGATTGGTATGACATCAAGGCTCCCTCCAACTTCACTCACAGAAATGTCGGAAAGACACTTGTTTCTAGAACTCAGGGTA
CCAAGATTGCATCAGAGGGTTTGAAACACAGAGTTTTCGAGGTTTCTCTTGCTGATCTCCAAGGTGATGAGGATCACGCT
TACAGGAAGATCCGTCTCAGAGCTGAAGATGTCCAGGGCAGGAATGTCTTGACCCAGTTCTGGGGTATGGACTTCACAAC
CGACAAGCTCAGGTCCTTGGTTAAAAAGTGGCAGACTTTGATCGAGTCTCATGTCGATGTCAAAACCACCGACAACTACA
CACTGAGGCTTTTCTGCATCGCCTTCACCAAGAGACGTGCTAACCAAGTCAAGAGAACTTGCTATGCTCAATCTAGCCAA
ATCCGTCAGATTCGCAGCAAGATGAGGGAGATCATGATCAAGGAAGCTTCGTCTTGTGACCTCAAGGAGCTTGTTGCCAA
GTTTATTCCCGAAGCTATTGGGAAGGATATTGAGAAGGCGACTCAGGGCATCTATCCTCTTCAGAATGTTTTCATCCGTA
AAGTCAAGATCCTCAAGGCTCCCAAATTCGACCTTGGAAAGCTCATGGAGGTTCACGGAGACTACACAGCAGAGGATGTT
GGTGTGAAGGTTGACAGGCCGGCCGATGAGACTGCTGCCGAGGAACCTACTGAGATCATTGGAGCTTAA