Details for Chinese cabbage Locus Brara.E03417

Position : A05 ( 5`- 27251897 .. 27255274 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03417

Protein [Map View]
MASSIVFAATPATRFLSSVPPLKSRRFHVKSSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELL
DQGHEVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFINKGSEIGELDFRF
PVGAPIHGIRAFLVTNQLKPYDKLRNSLALALSPVVKALVNPDGAMKDIRNLDSISFSDWFLSKGGTRASIQRMWDPVAY
ALGFIDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPDTYLSGPIKQYITDRGGRIHLRWGCREILYDKTSDGETYVTG
LAVSKATDKKVVKADVYVAACDVPGIKRLLPKEWRESRFFNDIYELEGVPVCTVQLRYNGWVTELEDIELSRQLKRAVGL
DNLLYTPDADFSCFADLALASPADYYIEGQGSLLQCVLTPGDPYMRLPNDKIIEKVAMQVTELFPSSRGLEVTWSSVVKI
AQSLYREAPGKDPFRPDQKTPVKNFFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKLSSSSVSDELSLV
*

DNA
ATGGCTTCTTCGATCGTTTTCGCTGCAACTCCTGCTACTCGGTTTCTCTCCTCTGTTCCTCCTTTGAAGTCTCGGAGATT
TCATGTTAAGTCTTCTCTCGACGCAGACGTTTCCGACATGAGTGTTAACGCTCCAAAGGGTCTGTTTCCACCAGAGCCTG
TACCTTACAAGGGACCGAAGCTGAAAGTAGCTATCATTGGAGCTGGACTTGCAGGCATGTCAACTGCTGTTGAGCTTCTC
GATCAGGGTCACGAGGTGGATATATATGATTCAAGGACATTCATTGGTGGCAAAGTTGGTTCTTTTGTAGATAGACGAGG
GAACCATATCGAAATGGGACTACATGTTTTCTTCGGATGCTACAACAATCTCTTCCGCTTAATGAAAAAGGTGGGAGCTG
ATAAGAACCTTCTTGTCAAAGACCACACTCATACGTTTATAAACAAAGGCAGCGAAATTGGAGAGCTTGATTTTCGGTTT
CCTGTTGGAGCTCCAATTCACGGTATCCGTGCGTTTCTAGTCACAAACCAACTCAAGCCCTATGACAAGCTGAGGAACTC
ACTAGCTCTTGCATTAAGCCCTGTCGTTAAAGCTCTTGTTAACCCTGATGGAGCTATGAAAGACATTCGCAACCTGGACA
GTATAAGTTTTTCGGATTGGTTCCTCTCGAAAGGTGGGACGAGGGCGAGTATCCAGAGGATGTGGGATCCTGTTGCTTAT
GCACTCGGTTTCATAGACTGTGACAACATGAGTGCGAGATGCATGCTTACCATATTCTCCCTATTCGCCACCAAGACAGA
AGCTTCTTTGTTGCGTATGCTCAAGGGCTCCCCTGATACTTACTTGAGTGGTCCTATCAAACAATACATCACAGATAGAG
GTGGCAGAATCCATCTAAGGTGGGGATGCAGGGAGATACTTTATGATAAAACATCAGATGGAGAAACGTATGTCACAGGA
CTAGCAGTTTCCAAGGCTACGGACAAGAAGGTTGTGAAAGCTGATGTGTATGTTGCAGCATGCGATGTGCCTGGAATCAA
AAGGTTACTACCCAAAGAATGGCGAGAATCTCGTTTCTTCAACGACATATACGAACTGGAGGGAGTACCTGTTTGCACGG
TGCAGCTCAGATACAATGGTTGGGTCACTGAGTTAGAAGACATTGAACTCTCCAGGCAGTTGAAACGTGCGGTTGGTTTG
GATAACCTTCTCTACACTCCTGATGCTGATTTCTCCTGTTTTGCGGATCTTGCACTCGCTTCGCCTGCTGATTATTACAT
TGAAGGACAAGGCTCTCTGCTTCAGTGCGTTTTAACTCCAGGTGATCCCTACATGCGATTACCGAACGATAAGATCATAG
AGAAAGTAGCAATGCAGGTCACAGAGCTGTTTCCATCGTCGCGGGGTCTAGAAGTCACATGGTCGTCAGTTGTCAAAATA
GCTCAGTCTTTATACCGTGAAGCACCAGGCAAAGATCCATTCAGACCTGATCAGAAGACGCCTGTAAAGAACTTCTTCCT
CGCTGGTTCATACACAAAGCAGGATTACATAGATAGTATGGAAGGAGCGACCTTGTCAGGGAGGCAAGCTTCGTCTTACA
TCTGTGACGCCGGTGAAGAGCTAGCCGAGCTAAACAAGAAGCTTTCTTCTTCTTCAGTTTCTGATGAGCTAAGTCTTGTC
TAA