Details for Chinese cabbage Locus Brara.E03415

Position : A05 ( 5`- 27249318 .. 27251085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03415

Protein [Map View]
MAGVTSQIFISSSSTLRRVGHRSPRCFSGSPEKKTPAILKWAVGGVTEVLRLLSVASSPSTTVRINEDKSDYEENARDID
DVMEILRSDYGNDYFVTGIFTTAIYSDDCIFADPTISFQGTELYERNLRLLVPFLEDASIELKNMDKSDLSQGNYIRATW
KLRTYLKLPWRPLISIDGSTVYELDRDFKIVRHVESWSVSAVEAIRQIFTFNSFTSRS*

DNA
ATGGCGGGAGTGACTTCCCAGATATTTATCAGCTCATCTTCGACCCTGAGGAGGGTTGGTCATCGGTCGCCGAGATGCTT
CTCTGGATCGCCGGAGAAGAAAACTCCGGCTATCTTGAAGTGGGCGGTTGGCGGAGTCACTGAAGTGCTACGTTTGTTAT
CCGTCGCTTCGTCTCCTTCTACCACCGTTCGTATAAATGAGGATAAATCAGATTATGAGGAAAATGCTCGAGATATTGAT
GATGTGATGGAGATTTTGAGATCAGATTATGGAAATGATTATTTCGTCACAGGAATCTTCACTACTGCAATTTACTCTGA
TGATTGCATCTTCGCGGACCCGACAATCAGCTTTCAGGGTACAGAGTTGTATGAACGCAACTTGAGATTACTGGTTCCGT
TCCTTGAAGATGCATCCATTGAACTGAAAAATATGGACAAGAGTGATTTGTCCCAAGGAAACTATATACGGGCGACGTGG
AAGCTAAGAACTTACCTGAAACTTCCATGGAGACCATTGATATCGATCGACGGAAGTACGGTCTATGAACTTGATAGAGA
CTTCAAAATTGTGAGGCATGTTGAGAGCTGGAGTGTCTCTGCGGTTGAAGCAATCAGGCAGATATTCACCTTCAACTCTT
TCACCTCTCGGAGCTGA