Details for Chinese cabbage Locus Brara.E03412

Position : A05 ( 5`- 27236223 .. 27238247 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03412

Protein [Map View]
MTSDQRDVVFSLESPDLEEGAAGDGGESDTDEDLRENDDVAIPETNEEPEDDDPEEEDLTAAVTVSASSTDAVTVALPAG
SAVPVSVIPVDSSDPKWHRVTEIVHHQRPLPPPTPIDDSRRLFQRLWTDEDEIELLRGFLDYVATHRGGNSSHPPDTAPF
YEMIKSKLQLEFNKNQLVEKLRRLKKKYRNVMSKISSGKEVFFKSPHDQSTFEISRKIWNQTGKIIGFEDNNAMDFEETN
TNGNYFNSPGGLNPSNVEIDSENGVERRLMMSSSSGGSRKRSRSRIGKIEEDNKPNITPSEGQTPNAASNVNLNEPATAV
IGGNIGVLIEETVKNCVSPVIKEMMNGTTSMMMAAMGGGSSHGHGFGSFSPVFTRPLGYGVEGGGNKAVSDERWRKQQIL
ELEVYSRRLELVQEQIRATLHELKTMPSGV*

DNA
ATGACATCTGATCAACGCGACGTCGTTTTCTCCCTCGAGTCACCGGATCTAGAAGAAGGAGCCGCTGGAGATGGAGGAGA
GTCCGATACAGACGAGGATCTACGCGAAAATGATGACGTGGCGATTCCCGAAACAAACGAAGAACCCGAAGACGACGATC
CGGAAGAGGAAGATCTAACGGCCGCCGTAACCGTCTCCGCCTCCTCAACAGACGCCGTAACCGTCGCGCTCCCGGCCGGA
TCCGCCGTCCCGGTCTCCGTGATCCCCGTCGACTCCTCCGATCCCAAATGGCACCGCGTGACGGAGATCGTCCACCACCA
GAGACCACTCCCGCCGCCGACGCCGATCGACGACTCTCGCCGCCTCTTCCAGAGGCTCTGGACCGACGAGGACGAGATCG
AGCTCCTCCGCGGGTTCCTCGACTACGTGGCGACGCACAGAGGAGGGAACAGCTCGCACCCGCCCGATACGGCGCCGTTT
TACGAGATGATCAAGTCCAAGCTCCAGCTCGAGTTCAACAAGAACCAGCTCGTGGAGAAGCTGAGGCGGCTCAAGAAGAA
GTACAGGAACGTGATGAGCAAGATTAGCTCTGGCAAGGAAGTGTTCTTCAAGAGCCCTCACGATCAGTCTACCTTCGAGA
TCTCGAGGAAGATTTGGAATCAGACTGGGAAGATCATTGGGTTTGAGGATAACAATGCGATGGATTTTGAGGAGACTAAT
ACTAACGGTAACTACTTTAACAGCCCTGGTGGTTTGAATCCGAGTAATGTTGAGATTGATTCTGAGAACGGAGTTGAGAG
GAGATTGATGATGAGTAGTAGTAGCGGAGGATCAAGAAAACGATCAAGATCGAGAATTGGGAAGATTGAGGAAGACAACA
AACCGAACATCACTCCCTCTGAGGGGCAAACACCAAACGCAGCTAGCAATGTGAACCTCAACGAGCCGGCGACGGCTGTT
ATCGGTGGAAACATTGGTGTTCTGATTGAAGAGACTGTGAAGAACTGCGTCTCTCCTGTGATCAAGGAGATGATGAACGG
GACGACGAGTATGATGATGGCTGCAATGGGAGGAGGGTCTAGTCATGGTCATGGCTTTGGCTCGTTTAGTCCCGTGTTTA
CACGGCCGTTAGGTTATGGTGTAGAAGGAGGAGGGAACAAGGCGGTGAGTGATGAGCGGTGGAGGAAGCAACAGATTCTG
GAGCTGGAAGTGTATTCGAGGAGGTTAGAGCTGGTTCAAGAGCAGATTAGAGCTACATTGCATGAGTTAAAGACCATGCC
GAGTGGTGTATGA