Details for Chinese cabbage Locus Brara.E03386

Position : A05 ( 5`- 27085448 .. 27086842 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03386

Protein [Map View]
MRRSDHAFSGVLPVVFLCILSAAELVAGQGQPDQRNEVYSYGKISPAMAVIVVILIAALFFMGFFSIYFRHYSALPDAAV
SPAGGARPRGVFNAAVARGLDVSVVETFPTFVYSEVKTQKLGKGELECAICLNEFEDDETLRLVPKCDHVFHPHCIGAWL
EAHVTCPVCRANLAEQVAKDESVEPDVELQQVVVSPEPVVIAPVQEQSVTSEIDSRRLPGVPVDLKRAKFSRSHTTGHLV
VQPGECTERFTLRLPEDARKRMMANWKLNRSNSLLVLPRGGSSRRGKPIDRSRARSDRWLYRKTSSFLWRSRDDGSIKLG
GTGSVRTNAVSNSTGDSVRSDRWAILRNASFLWRNSSVQGRKDKEGTSVKPPGTGGSTSGSERLPV*

DNA
ATGAGAAGATCTGATCACGCTTTCTCCGGTGTTTTACCGGTTGTTTTCTTGTGTATATTATCAGCGGCGGAGCTAGTAGC
GGGTCAAGGACAGCCCGACCAGAGAAATGAAGTGTATAGCTACGGCAAGATAAGTCCAGCCATGGCAGTGATCGTCGTGA
TCCTCATCGCTGCTCTCTTCTTCATGGGCTTCTTCTCCATCTACTTCCGCCACTACTCCGCCTTACCCGACGCCGCCGTT
TCCCCAGCCGGCGGAGCTAGACCCAGAGGAGTCTTCAACGCGGCGGTGGCACGTGGACTCGACGTCTCCGTGGTGGAGAC
TTTCCCGACGTTCGTGTACTCCGAGGTGAAGACGCAGAAGCTGGGGAAAGGTGAGTTGGAGTGTGCCATTTGTCTGAACG
AGTTCGAAGACGACGAAACGCTGCGTTTGGTTCCCAAATGCGATCACGTGTTTCACCCTCACTGCATCGGTGCATGGCTC
GAGGCTCACGTGACTTGTCCGGTTTGCAGAGCGAATCTCGCTGAGCAAGTGGCTAAAGACGAATCGGTCGAACCGGATGT
TGAGTTACAGCAGGTGGTGGTGAGTCCCGAACCGGTGGTTATTGCTCCGGTACAGGAACAATCGGTTACGAGTGAGATTG
ATTCGAGGAGATTGCCTGGAGTACCGGTGGATCTTAAACGAGCCAAGTTCTCGAGATCGCATACGACGGGACATTTGGTG
GTTCAACCGGGAGAATGTACCGAACGGTTTACTCTCCGGTTACCGGAAGATGCGAGGAAGAGGATGATGGCGAATTGGAA
GCTAAACCGGTCGAATAGTCTTCTTGTTCTTCCTAGGGGAGGGAGCTCGAGGAGAGGTAAACCGATCGACCGGTCAAGAG
CTCGGTCTGATCGATGGTTATACCGTAAAACGTCGTCGTTTCTGTGGAGGAGTCGAGATGATGGTTCGATTAAGCTAGGT
GGAACCGGCAGCGTTCGAACCAATGCTGTATCGAATTCAACCGGTGATTCGGTACGATCAGACCGGTGGGCTATTCTTAG
AAACGCGTCATTTTTATGGAGGAACTCTTCGGTTCAGGGAAGAAAGGACAAGGAAGGAACTTCAGTTAAACCTCCTGGTA
CAGGTGGCTCAACTAGCGGTTCGGAGAGATTACCGGTTTAG