Details for Chinese cabbage Locus Brara.E03385

Position : A05 ( 5`- 27081711 .. 27084008 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03385

Protein [Map View]
MANEDDEVEKSRGTPQQIGNKPKTQIVIGVPSYQEVVESSQTKSTPPSLFKPSQTFSQAFAFVKSSDVYSAPPPPPPLTS
SSGASHVPSTSQTPQTDVASSSTPPVATGSLSTNTTQPRNAILVSNRQKGNPLLKHIRNVKWVFSEIIPDYLLGQTTCAL
YLSLRYHLLHPDYLYFRIRELQKNFKLRVVLCHVDVEDSVKPLLEVTKTALLHDCTLLCAWSLTECARYLETIKVYENKP
ADLIQGQMDTDYLSRLNHSLTSIRHVNKSDVVTLGSTFGSLAHIMDASMEDLARCPGIGERKVKRLYDTFHEPFKRAASS
YPSVVEPTVTETEVQKDVNSEEPVVEEDEDFVEDSRKRKKKEPEKSVKTALSTVFARYSDKLCKKKEKDTRTDSDAETHQ
D*

DNA
ATGGCGAACGAGGACGACGAAGTAGAGAAATCACGAGGGACGCCACAACAGATTGGTAACAAACCCAAAACCCAGATCGT
AATTGGTGTTCCATCGTACCAGGAAGTCGTGGAAAGCTCACAGACTAAGTCCACGCCACCATCTCTCTTCAAGCCTTCCC
AGACTTTCTCTCAAGCATTCGCTTTCGTCAAATCCTCCGACGTCTACTCTGCTCCTCCTCCTCCTCCTCCTCTGACTTCT
TCTTCCGGCGCTTCTCATGTGCCCAGTACAAGCCAAACGCCTCAAACAGATGTAGCTTCATCTTCTACTCCTCCTGTAGC
TACTGGCTCTCTATCTACGAACACTACTCAACCACGTAACGCGATTCTCGTTAGCAATAGACAGAAAGGGAATCCTCTTC
TTAAACATATCAGGAACGTGAAATGGGTTTTCTCAGAGATCATCCCTGACTACTTACTTGGTCAAACCACTTGCGCTTTG
TATCTAAGCTTGCGGTATCATCTCCTCCACCCGGATTATCTCTACTTCCGCATCAGGGAACTACAGAAGAACTTCAAGCT
CCGTGTTGTTCTTTGCCACGTCGACGTTGAAGATTCGGTGAAACCGTTGCTTGAAGTCACCAAAACCGCTCTTCTCCATG
ACTGCACCCTATTGTGCGCCTGGAGCTTGACGGAATGTGCTCGTTACTTGGAGACGATTAAAGTCTATGAGAACAAACCT
GCGGATCTCATACAAGGCCAGATGGATACAGACTATCTCTCACGTCTAAATCATTCTCTTACAAGCATCAGACATGTGAA
CAAGAGCGATGTAGTCACACTTGGTTCTACATTTGGGTCACTTGCTCATATAATGGATGCATCCATGGAAGATCTAGCTC
GTTGCCCTGGTATTGGCGAACGCAAGGTGAAGCGGTTGTACGATACGTTCCACGAACCTTTCAAGCGTGCAGCTTCGAGC
TACCCGTCTGTTGTAGAACCGACAGTTACGGAGACTGAAGTTCAGAAGGATGTGAACTCAGAGGAACCTGTTGTTGAAGA
AGACGAGGATTTTGTGGAGGACTCGAGGAAACGCAAGAAGAAGGAGCCTGAGAAAAGTGTGAAGACTGCGCTCTCGACTG
TTTTTGCTAGATACTCTGATAAGCTCTGCAAGAAAAAGGAGAAAGATACAAGAACAGACTCAGATGCTGAAACCCACCAA
GATTAA