Details for Chinese cabbage Locus Brara.E03382

Position : A05 ( 5`- 27068159 .. 27069945 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03382

Protein [Map View]
MHSFGYRANALLTFSVTALAFICAIASFSDKFSNQNPSAEIQILNINRLKKQSYGNDEVSLTLDISADLQSLFTWNTKQV
FAFVAAEYESPMNSLNQVSLWDVIIPDKEHAKFRIQTSNKYRFIDQGHNLRGKEFNLTLHWHVMPKTGKMLADKIVMPGY
SLPDAYK*

DNA
ATGCATTCATTTGGATACAGAGCAAATGCTCTGCTCACGTTCTCCGTCACGGCGCTGGCTTTCATCTGCGCGATCGCGTC
CTTCTCTGACAAATTCAGCAACCAGAATCCCTCTGCTGAGATCCAGATACTTAACATCAATCGTCTTAAGAAGCAGTCTT
ATGGCAATGATGAGGTCAGCTTGACACTGGACATATCGGCAGACTTGCAGTCACTGTTTACTTGGAACACCAAACAGGTT
TTCGCTTTCGTGGCAGCGGAATACGAATCCCCAATGAACTCCCTGAATCAGGTTTCTCTATGGGATGTGATTATCCCTGA
TAAGGAGCATGCCAAGTTTAGGATTCAAACCTCAAACAAGTACCGTTTCATTGATCAGGGACATAATCTTCGTGGGAAAG
AGTTCAACTTGACGTTACACTGGCATGTCATGCCCAAGACCGGAAAGATGCTTGCTGACAAGATCGTCATGCCTGGTTAC
AGCTTACCAGATGCATACAAATGA