Details for Chinese cabbage Locus Brara.E03381

Position : A05 ( 5`- 27066928 .. 27068613 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03381

Protein [Map View]
MKKHYKPILSKLENCRTMTELNQLHALMIKSSVIKNIIPLSRLIDFCTTSLETTNLTYASSVFETIDSPSVYIWNSMIRG
YSNSPKQDKALTFYREMVRKGYSPDHFTFPYVLKACSVVRDVWLGRCSHGFVVKTGFVVNMYVSTCLLHMYMCCGEVECG
LKVFEGVPKWNVVGWGSLVSGFVSNNRFREAIEVFSEMERYGVKVNETVMVDLFVACGRCKDVERGKWFHGLVKELGFDP
YCKSEDGFNVILATSLVDMYGKCGELRTARYLFDEMPKRSLVSWNSIITGYSQSGDGEEAMRLFSDMIGLGFSPDKVTFL
SVIRASMIQGSGRMLHGFVLKTGFVNDAAVVCALVNMYAKRGDAESAKRAFEDLEKKDTIAWTVVIIGLASHGHGKEALS
VFQRMREEGNAKPDGITFVGVLYACSHVGLVEEGRRYFKEMRDVYGIEPTVEHYGCMVDILSRAGCFEEAERLVKTMPVQ
ASANVWGALLNGCEIHENFDLADRIRSVVSESEELGSGIYVLLSNIYARAGRWSDVKVVRESMNSRRIAKVLGHSSVETT
F*

DNA
ATGAAGAAGCACTACAAACCAATCCTCTCCAAACTGGAGAACTGCAGAACAATGACGGAACTAAACCAACTCCACGCCCT
CATGATCAAATCCTCTGTCATCAAAAACATCATCCCCTTAAGCCGCCTCATAGACTTCTGCACCACCTCCCTAGAGACCA
CGAACCTCACCTACGCGTCCTCAGTTTTCGAAACCATCGATTCCCCGAGCGTGTACATATGGAACTCCATGATCAGAGGC
TACTCAAACAGTCCCAAACAAGATAAAGCACTGACCTTTTACCGAGAAATGGTTCGTAAAGGGTACTCTCCGGATCACTT
CACGTTTCCTTACGTCCTTAAAGCGTGTTCTGTGGTGAGGGATGTTTGGTTGGGGAGGTGTTCTCATGGGTTTGTTGTGA
AGACAGGGTTTGTTGTGAACATGTATGTTTCCACTTGTTTGCTTCATATGTACATGTGTTGTGGCGAAGTGGAGTGTGGT
TTGAAGGTTTTTGAGGGTGTGCCGAAGTGGAACGTTGTGGGTTGGGGGAGTTTGGTGTCTGGGTTTGTGAGTAATAATCG
GTTTAGGGAGGCTATTGAGGTGTTTAGTGAGATGGAGAGGTATGGTGTGAAGGTGAATGAGACTGTAATGGTGGATCTTT
TTGTTGCTTGTGGGAGATGTAAAGATGTTGAGAGAGGGAAATGGTTTCATGGGCTTGTTAAAGAGTTAGGCTTTGATCCG
TATTGTAAGTCAGAAGATGGTTTTAATGTGATCTTGGCGACGAGTTTGGTTGATATGTATGGGAAATGCGGAGAGTTGAG
AACCGCGAGGTATCTGTTCGACGAAATGCCTAAGAGAAGCTTGGTTTCTTGGAATTCTATTATTACAGGGTATAGTCAGA
GCGGTGATGGAGAGGAGGCGATGCGTTTGTTTTCGGATATGATTGGTTTGGGTTTCTCTCCTGATAAGGTTACGTTTTTG
AGTGTCATAAGAGCTTCCATGATACAAGGATCGGGACGAATGCTTCACGGTTTTGTATTGAAAACCGGCTTTGTGAATGA
TGCTGCTGTAGTTTGTGCGCTTGTGAATATGTATGCTAAAAGGGGAGATGCAGAGAGCGCGAAGAGAGCGTTTGAAGATC
TGGAGAAGAAAGATACAATAGCTTGGACGGTTGTGATCATCGGGTTAGCGAGTCACGGGCATGGGAAGGAAGCGTTGAGT
GTGTTCCAGAGGATGCGAGAGGAAGGTAATGCTAAACCTGATGGAATCACATTTGTTGGGGTGTTGTATGCGTGCAGCCA
TGTGGGGTTGGTGGAGGAAGGGCGAAGATACTTCAAGGAAATGAGAGATGTTTACGGCATAGAGCCAACGGTTGAGCATT
ATGGATGTATGGTTGATATCTTGAGCCGTGCTGGTTGTTTTGAAGAGGCGGAGAGATTGGTAAAGACTATGCCGGTACAA
GCAAGTGCTAATGTATGGGGTGCGTTGTTGAATGGCTGTGAGATTCATGAGAACTTCGATCTGGCTGATCGAATAAGATC
TGTGGTGAGTGAATCAGAAGAACTTGGTAGCGGAATCTATGTTCTGCTTTCTAATATCTACGCTAGAGCTGGACGGTGGA
GTGATGTGAAGGTGGTTAGAGAATCAATGAATAGCAGAAGAATAGCTAAAGTTTTAGGTCATAGTTCTGTTGAAACAACG
TTCTAA