Details for Chinese cabbage Locus Brara.E03379

Position : A05 ( 5`- 27062397 .. 27064370 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03379

Protein [Map View]
MASGFPPQKQETQPGVQHAMDPTPQFSSPNYKPSNKLHGKVALVTGGDSGIGRAVCHCYALEGASVAFTYVKGREDKDAD
ETLRLLHEAKTKEAKEPIMIATDLGFEENCKRTVDEVVNAFGCIDVLVNCAAEQHEVSIDEIEEARLERVFRTNIFSQFF
LAKYALKHMKEGSSIINTTSVVAYAGSSSLLEYASTKGAIVSFTRALALQLASKGIRVNGVAPGPVWTPLITASFSEEAI
KQFGSETPMKRAAQPVEVAPSYVFLACEHCSSYYTGQILHPNGGSIVNA*

DNA
ATGGCTAGTGGGTTTCCGCCGCAGAAGCAAGAGACACAACCAGGGGTACAACATGCTATGGATCCAACTCCTCAGTTCTC
TAGCCCTAACTACAAACCCTCCAACAAACTCCATGGAAAAGTGGCGCTAGTGACAGGAGGAGACTCAGGGATAGGTCGAG
CAGTGTGTCACTGCTACGCGCTTGAAGGAGCGAGCGTGGCTTTCACCTACGTTAAAGGCCGAGAGGACAAAGACGCAGAC
GAGACGCTGCGTTTGCTTCACGAGGCTAAGACAAAGGAAGCTAAAGAACCGATCATGATCGCCACAGATTTGGGGTTCGA
AGAGAATTGCAAGAGGACCGTTGATGAAGTTGTCAACGCCTTTGGATGCATCGATGTGCTTGTAAACTGTGCGGCTGAGC
AGCACGAGGTTTCCATTGATGAGATCGAGGAGGCCAGGCTCGAAAGAGTGTTTCGCACCAACATCTTCTCACAGTTTTTC
TTGGCCAAGTATGCATTGAAGCACATGAAGGAAGGGAGCAGTATTATCAACACGACATCGGTTGTTGCATATGCAGGAAG
CTCGAGTTTGCTAGAGTACGCGTCTACAAAAGGAGCTATTGTTTCCTTCACACGTGCGTTAGCTCTTCAGCTTGCATCAA
AGGGGATACGTGTCAACGGAGTAGCTCCAGGTCCGGTCTGGACTCCACTGATAACAGCTTCCTTCTCTGAAGAAGCGATC
AAACAGTTTGGGTCGGAGACACCGATGAAAAGAGCGGCTCAGCCTGTGGAAGTTGCTCCTTCTTACGTCTTCTTGGCTTG
TGAACATTGCTCTTCTTACTATACCGGCCAGATCCTTCATCCAAACGGTGGTTCTATCGTGAACGCTTGA