Details for Chinese cabbage Locus Brara.E03378

Position : A05 ( 5`- 27058630 .. 27061814 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03378

Protein [Map View]
MDRRSWLWRRKSSEKSPGETESTGSLSSHSERFSDDQRSHSPELISKPVTREEEEVEEEATADIKILTERLSAALLNVSL
KDDLAKQHAKVAEEAVAGWEKAENEAAALKQQLDASVSKVSALEDRNTHLDSALKECVRQLWQGREEQNQKIEEAINKKC
SEWEATKAELESRIEELQARLQTGKQEDATALEKENSALKLELLSKAEEVKILTLERDLSTQAAESASKQQLEGIKKLTK
LEVECRKLRVMVQRSVKSNDLKSCTDNQSEYSGRFSFSDNEVQSPTTQRASGKAPSVDIGLMDDFLEMEKLASMPRSEPG
RKHSESKPDAQSSQLKHLHRITELEEKVEMVEVEKLQLEMALNESKEQVDALQSQLMETEEKLSKLKKLEPRTQELELSL
DESRKQIHDLQRQLNRTQTDMSKLETTRAENNDLELLLSESGSQIQDLQKQLNKAQVNLSELETIRAEKLELTICLNGTK
KELETSQSRLKETERKLTEVQTLLRLTKDAKEAAEDGVKAANAKAEAVESRLRDVEAETESLILKIESLEESVEKERVLS
AKHSSKCEELQDEISKLKHKLEHHGEGEHEPNHLRAFDDDYKLKQEKELAVAASKFAECQRTIASLGQRLQSLATLEDFL
IEP*

DNA
ATGGACCGGAGAAGCTGGTTATGGCGGAGAAAGTCTTCTGAGAAAAGTCCTGGCGAGACAGAGAGTACTGGCTCACTCTC
TTCTCATTCTGAAAGATTCTCAGACGATCAGAGATCTCACTCACCGGAATTAATATCTAAACCTGTAACAAGAGAAGAAG
AAGAGGTAGAAGAAGAGGCAACGGCGGATATCAAGATTCTAACGGAGAGGCTCTCTGCAGCTCTTTTAAACGTCAGTTTA
AAAGACGACCTTGCCAAGCAGCATGCCAAAGTCGCAGAGGAAGCTGTCGCAGGTTGGGAGAAGGCAGAGAACGAAGCTGC
GGCTCTGAAGCAACAGCTTGATGCTTCTGTAAGCAAAGTCTCGGCTCTCGAGGATCGAAACACTCATCTTGATAGTGCAC
TCAAGGAATGTGTGAGACAACTCTGGCAAGGAAGAGAAGAGCAAAACCAAAAGATCGAAGAAGCTATAAACAAGAAATGC
TCAGAGTGGGAAGCTACAAAAGCTGAACTTGAATCCCGAATCGAGGAGCTCCAAGCCAGACTTCAAACTGGAAAACAAGA
AGATGCTACTGCTTTGGAGAAAGAGAACTCAGCTTTGAAGCTAGAGCTACTCTCAAAAGCAGAAGAGGTCAAGATATTAA
CTCTTGAGAGGGACTTGAGCACTCAAGCCGCTGAATCCGCTAGTAAACAGCAGTTGGAAGGGATTAAAAAGTTGACTAAA
CTCGAAGTAGAATGCAGGAAACTGAGAGTCATGGTTCAGAGATCTGTCAAGTCAAATGATCTAAAGTCTTGTACAGATAA
CCAATCAGAATACTCAGGGAGATTCTCATTTAGTGATAATGAAGTGCAGAGTCCTACTACTCAGAGGGCTAGTGGGAAGG
CTCCTTCAGTAGATATCGGTTTAATGGATGATTTTCTCGAGATGGAGAAGCTAGCTTCTATGCCGCGTTCTGAACCGGGA
AGAAAACATTCAGAGAGTAAACCTGATGCACAATCAAGCCAACTAAAACATCTTCACAGGATTACTGAACTAGAGGAAAA
GGTAGAGATGGTAGAGGTGGAGAAACTGCAGCTGGAGATGGCTTTGAATGAATCCAAAGAGCAAGTGGATGCACTGCAGA
GTCAATTGATGGAGACAGAGGAGAAGTTATCCAAGTTGAAGAAACTGGAACCAAGAACTCAAGAGCTAGAGTTGTCATTG
GATGAATCTAGAAAGCAGATTCATGATCTTCAAAGACAGCTAAACAGAACACAAACTGATATGTCAAAACTAGAGACCAC
AAGAGCAGAAAACAATGATCTAGAGCTGTTGCTGAGTGAATCCGGAAGTCAAATTCAAGATCTCCAAAAGCAGCTAAACA
AAGCACAGGTGAATCTGTCAGAGCTAGAGACTATAAGAGCAGAGAAGCTGGAACTGACCATATGTTTAAACGGGACAAAG
AAGGAGCTAGAGACATCTCAAAGCCGGCTAAAGGAAACAGAGAGGAAGCTAACAGAGGTTCAGACTCTGCTGCGACTAAC
AAAAGATGCAAAAGAAGCGGCTGAGGATGGTGTAAAAGCTGCAAACGCTAAAGCAGAAGCGGTTGAGTCAAGACTCAGAG
ATGTGGAAGCAGAAACCGAATCTCTGATCTTGAAGATCGAATCTTTGGAAGAGAGTGTAGAGAAGGAACGTGTGTTATCA
GCAAAACACAGTTCAAAGTGTGAAGAACTACAAGATGAGATCTCAAAGCTAAAACATAAACTTGAGCATCATGGAGAAGG
AGAGCATGAGCCTAACCATTTGAGAGCTTTTGATGATGATTATAAACTGAAACAGGAGAAGGAACTAGCAGTGGCTGCCT
CAAAATTTGCAGAGTGCCAGAGAACTATTGCTTCACTGGGTCAGAGATTACAGTCGCTTGCTACACTTGAAGATTTCTTG
ATTGAACCTTGA