Details for Chinese cabbage Locus Brara.E03377

Position : A05 ( 5`- 27056167 .. 27057930 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03377

Protein [Map View]
MMTGGNYTTIDDSQKVSGSVPSVPDPGHTTVKFAESNLQTFPPSATQSKISGGTSNPPRDADDTFSGPGRSSTDEPQSGG
WLHKFTVGAYKPFFDVDTSDVVDRLKESLFPFRGTFTEKTADKPDLYGVFYGYVMIVPLGLYVVLKYFSAPSGLVQLFCL
YGYSLFIFIPALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVVLKLYLFTVTV
*

DNA
ATGATGACCGGCGGGAACTACACGACTATCGACGACAGCCAAAAAGTCTCTGGCTCTGTACCTTCTGTTCCAGATCCAGG
TCACACCACCGTCAAATTCGCAGAATCAAATCTTCAAACCTTTCCTCCATCTGCTACTCAGAGCAAGATCTCTGGTGGTA
CTAGTAATCCCCCTCGTGATGCCGACGATACATTTTCTGGGCCTGGTAGAAGTAGTACAGATGAACCTCAATCTGGTGGT
TGGCTCCATAAGTTCACTGTTGGTGCTTACAAGCCCTTCTTTGATGTCGACACTTCGGATGTTGTGGACAGGCTCAAAGA
ATCTCTCTTCCCATTCCGTGGAACTTTTACGGAGAAGACTGCCGATAAGCCTGACTTGTATGGAGTGTTCTACGGCTATG
TCATGATCGTTCCTCTCGGCTTATATGTCGTTCTCAAATACTTCTCTGCACCGTCAGGCCTAGTTCAGCTCTTCTGTCTC
TACGGCTATTCCCTCTTCATCTTCATCCCTGCTTTGTGCCTCTCGGTGGTACCAGTGGAGATCTTCAGATGGGTTATAGC
AGGTGTGGCAGGGTTCATGTCTGCGACTTTTGTTGCTCTGAACCTCAAAGCGCATATCAATTCCGCTGGGGAGAGATCGA
TCCTGATCATCGCAAGCATCTTTCTATTGCAGCTCGGGCTTGCGGTTGTGCTGAAGCTCTATCTGTTCACTGTCACAGTA
TGA