Details for Chinese cabbage Locus Brara.E03374

Position : A05 ( 5`- 27047894 .. 27050075 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03374

Protein [Map View]
MVARTPQKQRKVAMVVAPPLNSDLLRETINKVDKCMERLQELQYTIAGGTKVVSGVNLSPRSTRTYLKTSLRCKQETLRI
KNANNKKSPIGKFPASSPGDWRKMSLPAMLLGETVNEILKASQVTKDIVDALAPKKSRKLRRSIMPEEEEDGPKTPETHQ
KSKEQNPEAVSSNIKARRKKEKQNKRSEPTSPRARSRIVFKIVSPQTKAEKVQVKANRVSPKHKPWGKKAVLFPNPLFIS
GSSTQQAKFSRTMSPVIARSDLTSSKDTKKETPHKFLIKSPTKSPSKFQVRIKSPPKVSVSPNRNGGNLGRKSPARSASL
GKKSPPKLSAAGKLRRSFTPTRNGSNVARKSSISPKRVTLQAFISPARNCDLGKKSPKASISPSKKTQKLSTAAKLRRSF
SPSRLAMRLVSPMKSRKSVGRCDDDEKGMMVSGLRQRPVIVPKRFSMGRIS*

DNA
ATGGTTGCAAGAACCCCACAAAAGCAGAGGAAAGTGGCGATGGTGGTGGCGCCTCCTCTCAACTCAGATCTTCTCAGGGA
AACAATCAACAAGGTTGATAAATGCATGGAAAGATTGCAAGAGCTGCAATACACAATAGCAGGAGGGACCAAAGTTGTCT
CTGGTGTGAACCTTAGCCCTAGAAGCACTAGAACTTACTTGAAGACTAGCCTTAGATGCAAGCAAGAAACTTTAAGGATC
AAGAATGCTAATAACAAGAAATCTCCAATAGGAAAGTTTCCAGCTTCATCACCAGGAGACTGGAGGAAAATGTCACTACC
AGCAATGCTACTAGGAGAGACAGTAAACGAAATCTTAAAAGCCTCACAGGTCACCAAAGACATTGTAGACGCACTAGCAC
CAAAGAAGAGTAGAAAGTTAAGAAGATCCATAATGCCAGAAGAAGAAGAAGATGGCCCTAAAACACCTGAGACCCATCAG
AAATCCAAAGAGCAGAACCCTGAAGCTGTCAGCAGCAATATCAAAGCGAGAAGGAAGAAAGAGAAGCAGAACAAGCGTTC
AGAACCAACTTCTCCTAGGGCTCGTTCGAGAATTGTGTTCAAGATCGTCTCCCCACAGACAAAAGCAGAGAAGGTTCAAG
TAAAGGCTAATAGGGTTTCGCCAAAGCACAAACCTTGGGGGAAAAAAGCGGTTCTGTTCCCAAACCCTTTGTTTATTTCT
GGCTCCTCCACGCAACAAGCCAAGTTCAGTAGAACAATGTCTCCGGTGATAGCCAGAAGTGACCTAACCAGCAGCAAGGA
CACTAAAAAGGAGACGCCACACAAGTTCTTGATCAAGTCTCCTACCAAATCACCGTCCAAGTTTCAGGTCAGGATCAAGA
GCCCGCCTAAAGTCTCTGTTTCTCCTAACAGAAACGGAGGTAACTTGGGTCGGAAGTCACCGGCAAGAAGCGCTTCCTTG
GGGAAGAAGTCTCCGCCTAAGCTATCAGCAGCTGGGAAGCTCAGAAGATCATTTACTCCAACGAGAAACGGAAGTAACGT
GGCCCGCAAGTCGTCCATTTCTCCCAAAAGAGTCACCCTTCAAGCATTTATATCTCCGGCAAGAAACTGTGACTTGGGAA
AGAAGTCACCTAAAGCTTCCATTTCTCCGAGCAAGAAGACGCAGAAGCTATCAACTGCAGCAAAGCTGAGGAGGTCGTTT
TCACCATCAAGGCTAGCAATGAGGCTGGTGTCTCCAATGAAGAGCAGGAAAAGTGTAGGGAGGTGTGATGATGATGAGAA
GGGGATGATGGTGAGTGGCTTGAGACAGCGTCCGGTTATAGTTCCTAAGAGATTCTCGATGGGGAGAATCTCATAA