Details for Chinese cabbage Locus Brara.E03373

Position : A05 ( 5`- 27045416 .. 27047527 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03373

Protein [Map View]
MNSRWVIQKLTPHIPACLSTILCTSKILIQQSPSHKVSTFLLNHVDISLLLSICGREGWFPHLGPSLHASVVKSPEFFEP
VDADVHRNALVVWNSLLALYVRNGELIDARKLFDEMPMVDNVSRNTVFNGFMKNREIESGFVLLKRMLTPGGFDQATLTI
ALSVCDTPELCFVTKMIHALAVLSGYDNVIPVGNSLITSYYKCGCSVSGRQVFDEMVQRNVITWTAVITGLVQNELHEEG
LRLFSLMRRGVVQPNSVTYLSALSACSGSQRVMEGRQIHALLWKVGIESELRVESMLMDMYSKCGSIEDAWNVFESAEET
DEVSMTVMLAGLAQNGSEEEAIHFFIRMLQDGVEIDANVVSAVLGVSFVDNSLGLGKQLHSLVIKRRFSGNTFVSNGLIN
MYSKCGDLDDSLSVFRRMSEMNYVSWNSMIASFARHGHGLAALKLYEEMIRQDVKPTDVTFLSLLHACSHVKLINKGQEL
LKQMLDVHGIEPRTAHYACIVDMLGRAGRLEEAKRFIDSLPMKPDSLVWQALLGACSFYGDTQIGRYAAEQLFLSAPDSS
APHILMANIYSSRGQWKEREMTIKRMKAMGVSKETGVSWIAIENQTHRFVADDKLHPQAESIHDVLSELFVVMIDEGYIH
DKRLLST*

DNA
ATGAATTCGAGATGGGTGATTCAGAAACTCACCCCTCACATTCCTGCTTGCCTCTCTACCATCTTATGCACTTCGAAAAT
CCTAATCCAGCAGAGCCCAAGTCACAAAGTCTCCACCTTTCTCCTCAACCACGTCGACATCAGCCTCCTCTTATCCATCT
GCGGCAGAGAAGGCTGGTTTCCTCATCTGGGTCCTTCCCTCCACGCCTCTGTTGTCAAAAGCCCCGAGTTTTTCGAGCCC
GTTGATGCTGACGTCCATCGAAACGCTCTCGTTGTTTGGAACTCTCTTCTCGCTCTGTACGTTAGAAACGGAGAGCTAAT
TGATGCACGCAAGCTGTTCGACGAAATGCCTATGGTAGATAATGTTTCTCGGAACACGGTGTTTAATGGGTTTATGAAGA
ACAGAGAGATAGAGTCTGGTTTTGTGTTGCTCAAGAGAATGCTTACACCCGGTGGGTTTGATCAAGCGACCTTGACGATT
GCTTTATCGGTTTGTGATACTCCAGAGCTCTGTTTTGTTACCAAGATGATTCATGCTTTAGCTGTTTTAAGCGGTTATGA
CAATGTAATCCCCGTGGGGAACAGTTTGATCACGTCTTATTACAAATGTGGGTGTTCGGTTTCCGGGAGACAGGTTTTTG
ATGAGATGGTGCAAAGAAATGTTATAACTTGGACGGCTGTGATTACTGGTTTGGTGCAGAATGAGTTACATGAAGAGGGT
CTGAGATTGTTTAGTTTGATGCGTAGAGGAGTGGTTCAACCGAACTCAGTAACTTATCTGAGTGCTCTATCTGCTTGTTC
AGGCTCGCAGAGAGTTATGGAAGGGAGACAGATTCATGCTCTTTTGTGGAAAGTTGGGATTGAATCAGAGCTACGCGTTG
AGAGTATGCTAATGGATATGTACTCCAAATGTGGAAGCATTGAAGACGCCTGGAATGTTTTTGAGTCGGCTGAAGAAACT
GATGAAGTTTCGATGACTGTGATGTTAGCTGGTTTAGCACAAAACGGGTCAGAGGAAGAAGCTATACATTTCTTCATTAG
AATGCTGCAAGATGGTGTGGAGATAGATGCAAATGTAGTTTCAGCTGTTCTTGGTGTTTCGTTTGTGGATAACTCTTTGG
GTCTAGGCAAGCAACTTCACTCTTTGGTTATAAAACGAAGATTCTCCGGTAACACCTTTGTTAGCAACGGACTCATCAAC
ATGTACTCAAAATGCGGAGATCTGGATGACTCACTCAGCGTCTTTAGACGAATGTCGGAAATGAACTACGTTTCATGGAA
CTCGATGATTGCATCGTTTGCACGCCATGGACACGGATTAGCTGCCTTGAAACTATACGAAGAGATGATAAGGCAAGACG
TGAAGCCAACAGATGTTACCTTTTTGTCACTGCTCCATGCTTGTAGCCATGTAAAGCTGATCAACAAAGGGCAAGAGCTC
TTGAAACAGATGCTAGATGTCCATGGAATCGAGCCTAGGACAGCGCATTATGCGTGTATCGTTGACATGTTGGGGCGAGC
TGGTCGTCTAGAAGAAGCAAAGAGGTTTATAGACTCATTGCCAATGAAACCTGACTCTCTGGTGTGGCAGGCACTGCTTG
GTGCTTGTAGTTTCTACGGTGACACTCAGATAGGGAGATATGCAGCTGAGCAGTTGTTTCTCTCTGCACCTGATAGCTCA
GCCCCTCATATTCTGATGGCCAACATATACTCATCGAGAGGACAGTGGAAGGAGAGAGAGATGACGATCAAGAGAATGAA
AGCAATGGGAGTGAGTAAAGAAACAGGCGTAAGTTGGATTGCAATCGAGAATCAAACACACAGATTTGTTGCTGACGACA
AGTTGCATCCACAAGCAGAGTCTATACATGATGTTCTCTCTGAACTGTTTGTTGTTATGATAGATGAAGGTTACATACAT
GATAAGAGGTTACTCTCTACGTGA