Details for Chinese cabbage Locus Brara.E03371

Position : A05 ( 5`- 27034053 .. 27039781 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03371

Protein [Map View]
MGISIGERGISIQVSRQHLFTFSFPNSIFLLSFFFLLSLKPLVSNFSIDLSLSLFESKRLLLSGLLRFAFYAFSPSPSHV
TEKHLQMAPAVRKSRSVNKRFTNEPSPRKDAGSSRKNKQRKTKFSDKLGPQWTKAELERFYDYYRKYGQDWRKVAAAIRN
SRSVDMVEALFNMNKAYLSLPEGTASVAGLIAMMTDHYTVMEGSGSEGEGHDVPEAPRKQQKRKRPKPQLSDSREEDDRQ
QPVASTDGCLKFLKQARANGTHRRATGKRTPRVPVQTSRDDGEGATPRNKRARKQLDANDDVAAHFLGLTLTDASRREGS
PQVSESPNKRTEPSDNSPIKSWGKMSRTRKASREKKLESDREDVEGVGEMEAPRKVKRVYKKRVKVEEAECNDSDDNGGA
CSATEGSRIKSKRRKAGVGASRGTYSPRSPKEKDNKFTSGDEFDALQALADLSASLLPGALMESESSAQLKEERIENDMD
EKSSSPDDSHGEKADSEPDDSLLHAISAIGNVAYSRKPKSSRQLSTDCNAVPTEKPEPEPTSGSSKRKRKPKKLWDETPH
ESTRKKSTNKQKELAQEDVNMKSSLRTKRSGQVLPPQSKQLKVAKELEEATTTSDKKRSAMDVVEVATTKEVSDSGPASL
PQKPPNRRKMSLKKSLQERDNKSSETIHKASRSSRSLSEHELLLKDKLSTSLSHPLARRRCMFEWFYSAIDHPWFAKMEF
VDYLNHVGLGHIPRLTRLEWSVIKSSLGRPRRFSERFLQEEREKLKQYRESVRKHYTELRTGAREGLPTDLARPLAVGNR
VIAIHPKTREIHDGKILTVDHSQCNVLFDDVGVELVKDIDCMPLNPLEYMPEGLRRQVDKCLSIKKEAQLSGVSVIFPPC
GLENIDFSMNQSLNQGDMIAPILHGKVLTNTSSSPHQTNQSHIINYSKGREAEIQRVLALQHALDEKEMEPEMVEIVKGS
KTRAQAMVDAAIKAASSVKEGEDAIKMIQEALDMVGKHQPLRSSVVKHEEHANGGVEHHQNPSLSSDASKPMANNDFISQ
DGSSEKNEVQMPAELITSCVASWLMIQMCTERQYPPAEVAQLIDTAVTSLQPRCPQNLPIYREIQMCMGRIKTQILSLVP
S*

DNA
ATGGGGATTTCTATTGGCGAAAGAGGTATTTCTATTCAAGTTTCGCGGCAACATCTCTTCACATTTTCTTTCCCTAATTC
TATCTTTCTCTTATCTTTTTTTTTTCTTCTCTCTCTAAAACCCTTGGTTTCAAATTTCTCAATCGATCTCTCTCTCTCTC
TTTTTGAAAGTAAAAGGCTCCTGCTTTCCGGACTACTGCGTTTCGCTTTCTATGCGTTTAGTCCTTCTCCAAGTCACGTA
ACTGAGAAACACCTGCAGATGGCACCGGCGGTTAGGAAGTCGAGGAGTGTGAACAAGCGTTTCACCAACGAACCCTCGCC
GAGAAAGGATGCTGGGAGCTCCAGAAAAAATAAGCAGCGTAAGACGAAATTTTCTGATAAACTGGGACCTCAGTGGACTA
AAGCAGAGCTTGAGCGTTTCTATGACTACTACCGAAAGTACGGACAGGACTGGAGAAAGGTGGCTGCTGCTATTCGGAAT
AGCAGGTCTGTTGACATGGTGGAAGCTCTTTTTAACATGAATAAGGCTTATTTATCTCTTCCGGAAGGAACTGCCTCTGT
GGCTGGCCTTATTGCTATGATGACCGATCATTACACTGTCATGGAAGGGAGTGGCAGTGAAGGAGAAGGCCATGATGTAC
CAGAAGCACCGAGGAAACAGCAAAAGCGCAAACGCCCAAAACCTCAGCTTAGTGATTCTCGAGAGGAAGATGATAGGCAA
CAACCCGTTGCTTCAACTGATGGATGTCTCAAGTTTTTGAAACAAGCACGAGCTAATGGAACTCATCGACGTGCCACTGG
CAAACGTACACCTCGGGTTCCTGTACAGACTTCACGGGATGATGGGGAAGGCGCTACTCCACGAAATAAAAGAGCCAGAA
AGCAACTTGATGCCAATGATGATGTTGCTGCACATTTTTTAGGATTGACGTTAACAGACGCATCCAGAAGGGAAGGGTCT
CCACAAGTGTCTGAATCACCTAATAAAAGAACAGAACCCAGCGACAACTCGCCAATAAAGAGCTGGGGGAAAATGTCGCG
AACGAGGAAAGCTAGCCGAGAAAAGAAGCTTGAATCTGATAGAGAGGATGTGGAAGGAGTTGGCGAAATGGAGGCTCCAC
GGAAGGTTAAAAGGGTCTACAAGAAAAGAGTCAAAGTCGAAGAAGCCGAGTGTAATGATTCTGATGACAACGGTGGGGCA
TGCAGTGCCACTGAGGGGAGCAGGATTAAATCAAAGAGACGAAAGGCAGGTGTTGGTGCCTCAAGAGGGACATATTCACC
GCGCAGCCCAAAAGAAAAGGACAACAAATTTACTTCCGGAGATGAATTTGATGCTCTGCAAGCCTTAGCTGATTTGTCAG
CTTCATTGCTTCCGGGAGCTTTGATGGAATCAGAATCTTCTGCTCAGTTGAAGGAAGAGAGAATAGAAAACGACATGGAC
GAGAAATCTAGCTCACCAGATGATAGTCATGGGGAAAAAGCAGATTCAGAACCAGATGATAGTCTCCTTCATGCAATTTC
TGCTATTGGGAACGTTGCTTACAGTAGAAAACCAAAATCTTCAAGGCAACTATCCACTGATTGTAACGCTGTTCCCACGG
AGAAGCCTGAACCGGAGCCTACTAGTGGCAGTTCAAAAAGAAAACGGAAACCAAAGAAGCTATGGGATGAAACTCCACAT
GAATCTACTCGGAAGAAATCCACAAACAAGCAGAAGGAATTGGCTCAAGAAGACGTTAATATGAAGTCTTCGCTTAGAAC
TAAACGCTCTGGTCAAGTCCTCCCCCCACAGTCAAAACAGTTGAAAGTTGCTAAGGAGTTGGAGGAAGCTACTACAACGA
GCGATAAGAAAAGATCTGCGATGGATGTAGTAGAAGTGGCAACAACTAAAGAAGTTTCTGATTCGGGTCCAGCCAGTTTA
CCGCAGAAGCCTCCTAACAGGCGTAAGATGAGTCTGAAGAAAAGCTTACAGGAAAGGGATAATAAATCTTCTGAAACCAT
TCATAAAGCTTCTCGTAGCTCAAGATCTCTTTCAGAACATGAGTTGCTATTAAAGGATAAGCTTTCTACTTCCCTATCGC
ATCCCTTGGCACGTCGAAGGTGCATGTTCGAATGGTTTTATAGTGCCATCGACCATCCCTGGTTTGCAAAGATGGAGTTT
GTCGATTACCTAAATCACGTAGGACTTGGTCACATTCCTAGACTTACTCGTCTTGAGTGGAGCGTCATTAAAAGCTCTCT
TGGTAGACCGCGAAGATTCTCCGAGAGATTTTTACAGGAGGAGAGGGAGAAACTCAAACAGTACCGTGAGTCTGTGAGAA
AGCATTACACAGAGCTTCGAACAGGTGCAAGGGAAGGGCTTCCTACAGATTTGGCTCGGCCATTAGCAGTTGGGAATAGA
GTCATTGCCATCCATCCCAAAACACGAGAGATTCATGATGGGAAGATCCTCACTGTTGACCATAGCCAATGCAACGTTCT
GTTCGACGACGTGGGCGTTGAGTTAGTTAAAGACATTGATTGTATGCCTTTAAATCCGTTGGAATACATGCCAGAGGGTC
TGAGGAGGCAAGTTGATAAGTGCTTGTCCATAAAGAAAGAAGCACAGCTAAGTGGTGTGTCTGTTATATTCCCTCCATGC
GGACTTGAGAATATCGACTTCTCCATGAATCAATCTCTGAACCAGGGTGATATGATTGCTCCCATTCTACATGGTAAAGT
GTTAACAAACACTAGTAGTAGCCCACATCAGACCAATCAGTCACATATCATAAATTATAGCAAAGGGCGAGAAGCTGAGA
TTCAACGAGTACTTGCACTACAGCATGCTTTAGATGAAAAGGAAATGGAGCCTGAGATGGTAGAGATTGTCAAGGGTTCA
AAAACAAGAGCACAAGCAATGGTGGATGCAGCTATCAAGGCTGCATCATCTGTGAAGGAAGGAGAAGATGCCATCAAAAT
GATTCAAGAAGCCTTGGACATGGTTGGCAAACATCAGCCGTTGCGCAGCTCTGTGGTCAAACATGAAGAGCATGCAAACG
GCGGCGTAGAGCATCATCAAAACCCATCTCTCTCCTCAGACGCATCAAAGCCTATGGCTAACAACGATTTCATCTCGCAA
GATGGTTCATCAGAGAAAAACGAGGTTCAAATGCCTGCAGAGCTAATCACATCGTGTGTTGCCTCTTGGCTCATGATTCA
GATGTGCACAGAGAGGCAGTACCCTCCAGCTGAAGTGGCACAGCTTATAGACACAGCAGTTACAAGCTTGCAGCCTCGAT
GCCCCCAGAACCTACCGATCTACAGAGAAATCCAAATGTGTATGGGACGAATCAAGACTCAAATCCTCTCTCTAGTACCA
AGTTGA