Details for Chinese cabbage Locus Brara.E03365

Position : A05 ( 5`- 27011114 .. 27011693 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03365

Protein [Map View]
MKNVSFKLVFLVALLSLVFRQDLVKGRTLVPNRGGGNYHDPVCNSDDPSCNKPCNPENPNCAMKQGDMDTNRADRNYQDP
PCDPYYDPNCVKPCNPENPNC*

DNA
ATGAAGAACGTTTCCTTTAAACTTGTGTTCTTGGTTGCTCTTCTTTCTCTTGTCTTTCGACAAGATCTAGTGAAGGGTAG
GACATTGGTTCCAAATAGAGGCGGCGGGAATTATCACGACCCGGTTTGTAACTCGGATGATCCCAGTTGCAACAAACCTT
GTAATCCAGAGAATCCAAATTGCGCCATGAAACAAGGTGACATGGATACAAATAGAGCCGACAGGAACTATCAGGACCCG
CCTTGTGACCCGTATTATGATCCAAATTGCGTCAAACCCTGTAATCCAGAGAACCCAAATTGTTAA