Details for Chinese cabbage Locus Brara.E03361

Position : A05 ( 5`- 26995121 .. 26996611 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03361

Protein [Map View]
MAQTDINQPKLDMTKEEKERLKYLEFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESVEGAVKTVVGPVYHKYHDVPVE
VLKYMDQKVDMSVSELDRRVPPVVKQVSAQAISAAQIAPIVARALATEVRRAGVVETASGVAKSVYTKYEPAAKELYASY
EPKAEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVMAAEKGYRVSSYMPLVPTERISKIFGDEKTETKPLE
FHPLH*

DNA
ATGGCACAAACCGATATCAATCAGCCGAAACTAGATATGACAAAGGAGGAGAAAGAGAGGTTGAAGTATTTGGAGTTCGT
GCAAGCTGCTGCTGTTGAAGCATTGCTTCGCTTTGCTCTCATTTACGCAAAGGCCAAGGACAAGTCTGGTCCTTTGAAAC
CAGGTGTTGAATCCGTTGAAGGAGCTGTCAAGACTGTGGTCGGTCCTGTCTACCACAAGTACCATGACGTCCCCGTCGAG
GTTCTTAAATACATGGACCAGAAGGTTGACATGTCCGTGAGTGAGCTTGACCGCCGTGTCCCACCAGTGGTCAAACAAGT
GTCTGCACAAGCCATCTCAGCTGCTCAGATAGCTCCCATCGTGGCTCGTGCTTTAGCCACTGAGGTTAGACGTGCTGGCG
TTGTGGAAACCGCTTCTGGGGTGGCTAAATCCGTATACACCAAGTACGAGCCTGCAGCTAAGGAGTTGTATGCAAGCTAC
GAGCCGAAAGCGGAGCAGTGTGCAGTTTCGGCTTGGAAGAAGCTGAACCAGCTTCCTCTGTTCCCGAGGCTGGCTCAGGT
CGCTGTACCGACAGCTGCTTTCTGCTCTGAGAAGTACAATGATACGGTGGTGATGGCTGCCGAGAAAGGGTACAGGGTCT
CATCCTACATGCCTTTGGTTCCAACAGAGAGGATCTCAAAGATCTTTGGGGACGAGAAGACTGAGACTAAGCCGTTGGAG
TTTCATCCACTTCATTGA