Details for Chinese cabbage Locus Brara.E03360

Position : A05 ( 5`- 26990601 .. 26993105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03360

Protein [Map View]
MATPMVEDTSSFEEDQLASMSTEDIVRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVEI
LEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAM
EVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQ
LVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRA
DILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEV
NHEDFNEGIIQVQAKKKASLNYYA*

DNA
ATGGCAACTCCGATGGTAGAAGACACGTCAAGCTTCGAAGAGGATCAGCTCGCGTCCATGTCCACCGAAGACATCGTTAG
AGCTACTCGTCTCCTCGACAACGAGATTCGAATTCTCAAGGAAGACGCACAAAGAACAAATCTAGAATGTGATTCTTACA
AGGAGAAGATTAAGGAGAATCAGGAGAAGATTAAACTCAACAAGCAGCTTCCTTACTTGGTTGGCAACATTGTTGAGATA
TTGGAGATGAATCCTGAAGACGATGCTGAGGAAGACGGTGCTAATATTGACCTTGACTCGCAACGGAAGGGAAAGTGCGT
TGTGTTGAAAACCTCTACGCGACAGACAATCTTTCTACCAGTTGTTGGTCTGGTGGATCCCGATAGCCTGAAGCCTGGTG
ATTTGGTTGGAGTGAATAAAGACAGTTACTTGATTCTGGACACCTTGCCATCAGAGTATGACTCCAGGGTTAAAGCCATG
GAGGTCGATGAGAAACCTACCGAAGATTACAATGACATTGGAGGACTAGAGAAGCAGATCCAAGAGCTTGTAGAGGCAAT
CGTGCTCCCCATGACGCACAAGGAGCGTTTCGAGAAGCTGGGTGTTCGTCCACCGAAGGGAGTGCTTTTGTATGGTCCTC
CAGGGACTGGTAAAACTTTAATGGCACGTGCCTGTGCAGCGCAGACCAATGCCACCTTCCTAAAATTGGCAGGTCCTCAA
TTGGTCCAGATGTTTATTGGAGACGGAGCAAAACTTGTCCGTGATGCCTTTCAACTAGCGAAAGAGAAAGCTCCATGCAT
CATCTTTATAGATGAAATCGATGCCATTGGTACCAAGCGTTTTGACAGTGAAGTAAGTGGAGACAGGGAAGTGCAGAGGA
CTATGTTGGAGCTACTTAATCAGCTTGATGGATTCAGTAGCGATGAGCGTATTAAGGTGATTGCAGCCACTAACCGTGCA
GATATTCTGGACCCAGCACTCATGCGTTCTGGTCGATTAGACAGGAAGATTGAGTTCCCACATCCAACAGAAGAAGCAAG
AGCCAGAATCTTGCAGATTCACTCGAGGAAGATGAATGTACACCCAGACGTCAACTTTGAGGAGCTTGCAAGATCGACAG
ATGATTTCAATGGCGCTCAACTGAAAGCAGTATGTGTAGAGGCTGGCATGTTAGCTCTTCGTCGTGATGCCACAGAGGTG
AACCATGAGGACTTCAATGAAGGTATCATCCAAGTCCAGGCCAAGAAGAAAGCAAGTTTGAACTACTACGCCTAA