Details for Chinese cabbage Locus Brara.E03359

Position : A05 ( 5`- 26985541 .. 26988733 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03359

Protein [Map View]
MGLGNKLNKFNFGDTDLAHEGGAADGGDPRDEGDGFGSAACSICLDTVAKDGDRAWANLQCGHLFHLDCIGSAFNAKGVM
QCPNCRKIEKGQWLYANGCRSHPEFNVEDWFHEDEFFDIGGYSEVAFGVHWCPFGSSARLPSFDDAEFSPSSYHDLFSQQ
GYFTEPAAPTAGHPCPYVTYIGPVHSSSSSTGGVSESSTFTWNTGSSVSNEVPAPYGFPVDPHYHGWDYPSPPPPPQQHF
SLSVPNVGSPTQRTPPPAAARTSRANGPRPPQFMRPSYHGQTHSSSGRAGSSVAPPFPGSNARTRDRTQALQAYYQQSTA
QSHQQPDSPVVSRGPVFPSGRRPSRGSASSSSDQAGGSGFLRFNIWEREPYNMPLQHAYPVNQMDREPSIWTSSYNEGAG
SFLQRHGGGGGSS*

DNA
ATGGGTTTAGGCAATAAGCTTAACAAATTCAATTTCGGCGATACTGATCTGGCCCACGAAGGTGGTGCCGCTGATGGAGG
AGATCCTCGCGACGAAGGAGATGGCTTTGGCTCGGCTGCGTGTTCGATTTGTCTCGATACGGTTGCTAAAGACGGCGATC
GAGCGTGGGCTAATCTTCAATGTGGCCACCTGTTTCATCTTGATTGTATTGGCTCAGCTTTCAACGCAAAGGGCGTGATG
CAGTGCCCAAACTGTCGGAAAATAGAGAAAGGCCAGTGGCTTTACGCAAACGGTTGCCGTTCACACCCTGAATTTAATGT
CGAGGATTGGTTTCATGAAGATGAGTTTTTTGATATCGGAGGCTACTCCGAAGTGGCTTTTGGAGTTCACTGGTGCCCAT
TTGGAAGTTCAGCGCGTCTTCCTTCTTTCGATGATGCAGAATTTTCGCCGAGTTCATATCACGATCTTTTCAGCCAGCAA
GGTTACTTTACAGAACCAGCAGCGCCAACAGCAGGTCACCCATGTCCATACGTAACCTACATTGGCCCGGTTCATTCGTC
TTCCTCAAGCACTGGAGGCGTTTCAGAGAGTTCAACTTTCACTTGGAACACCGGCTCATCGGTTTCCAATGAAGTCCCAG
CTCCTTATGGTTTCCCTGTTGATCCACACTATCACGGCTGGGATTATCCCTCCCCTCCACCTCCACCGCAACAGCACTTC
TCCCTTTCTGTCCCAAACGTGGGCAGTCCAACTCAGCGCACTCCTCCACCAGCTGCTGCAAGGACTTCCCGTGCCAACGG
ACCAAGACCGCCGCAGTTCATGCGTCCATCATATCATGGTCAAACTCACAGTTCTAGTGGTAGAGCAGGGAGCTCGGTGG
CACCGCCTTTTCCGGGAAGCAACGCTCGGACAAGAGACAGAACGCAAGCTCTTCAAGCCTATTACCAACAGTCTACTGCA
CAGTCACACCAACAACCTGATTCTCCTGTAGTCTCTCGTGGGCCTGTATTCCCCTCTGGACGGAGGCCCAGTAGAGGGTC
AGCTTCATCTTCTTCGGATCAGGCAGGGGGGAGCGGGTTTCTCCGGTTTAACATATGGGAGAGGGAGCCTTATAATATGC
CATTGCAACATGCTTATCCGGTTAACCAGATGGACAGAGAACCATCCATTTGGACATCTTCTTATAATGAAGGAGCAGGA
AGCTTCCTTCAGAGGCATGGCGGCGGAGGAGGATCATCGTAA