Details for Chinese cabbage Locus Brara.E03357

Position : A05 ( 5`- 26960694 .. 26961825 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03357

Protein [Map View]
METQKTQAENPPKPAMSSCRKIVKDDANFLEDVKDHIDEFINASMDDHKNCFNKTIKKMFGLSKAVAEKQQAEEAKGVES
YLPLQTTLSD*

DNA
ATGGAGACGCAGAAGACTCAAGCTGAAAACCCGCCTAAGCCAGCCATGTCTTCGTGTAGAAAGATAGTCAAGGATGATGC
CAATTTTTTAGAAGACGTCAAGGACCACATTGATGAGTTCATCAATGCCTCCATGGATGATCACAAGAATTGTTTCAACA
AGACCATCAAGAAGATGTTCGGATTGTCGAAGGCTGTTGCAGAGAAGCAGCAAGCTGAAGAAGCTAAAGGAGTGGAGAGT
TATTTGCCTCTTCAGACAACTCTCTCTGATTAG